Basic Information | |
---|---|
Taxon OID | 3300015207 Open in IMG/M |
Scaffold ID | Ga0134540_1097037 Open in IMG/M |
Source Dataset Name | Mouse gut microbial communities from Hong Kong to study the effect of probiotic LGG - Drug W8 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Hong Kong |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 662 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → Clostridium → environmental samples → Clostridium sp. CAG:440 | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Mammals → Digestive System → Unclassified → Unclassified → Mouse Gut → Mouse Gut Microbial Communities From Hong Kong To Study The Effect Of Probiotic Lgg |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Hong Kong | |||||||
Coordinates | Lat. (o) | 22.3356 | Long. (o) | 114.1826 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F013656 | Metagenome | 269 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0134540_10970371 | F013656 | N/A | VIFLEKRYKEPNKLEMETTINVLYEENVISVYTNKPDLQKQLCKSIGEPEKEFVKGKSILASRWIIPLNEKSKISKMMLKANIFQL* |
⦗Top⦘ |