NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0167657_1000468

Scaffold Ga0167657_1000468


Overview

Basic Information
Taxon OID3300015079 Open in IMG/M
Scaffold IDGa0167657_1000468 Open in IMG/M
Source Dataset NameArctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-6b, vegetation/snow interface)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Bristol
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)10478
Total Scaffold Genes14 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil → Metagenomes Of Arctic Soils

Source Dataset Sampling Location
Location NameStorglaci?ren, Tarfala, Sweden
CoordinatesLat. (o)67.865505Long. (o)16.714941Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F096264Metagenome105Y

Sequences

Protein IDFamilyRBSSequence
Ga0167657_10004684F096264GGAGGMDVLKIRKQGNSLTVTLDQQTLGAANLHEGDLVTPSVRNGTIVLTPVEIRPRALALGRKVIAENRRVLDRLAKDDTRKVASGRR*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.