Scaffold Ga0167660_1025666

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0167660_1025666

Scaffold Ga0167660_1025666

Overview

Basic Information
Taxon OID	3300015078 Open in IMG/M
Scaffold ID	Ga0167660_1025666 Open in IMG/M
Source Dataset Name	Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-11a, vegetated hydrological feature)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Bristol
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	651
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil → Metagenomes Of Arctic Soils

Source Dataset Sampling Location
Location Name	Storglaci?ren, Tarfala, Sweden
Coordinates	Lat. (^o)	67.904687	Long. (^o)	18.610965	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F035811	Metagenome	171	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0167660_10256661	F035811	N/A	FNLGPAIDVGTYNLKLSVNGKDYTTKVVIEPDPGIQF*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.