Metagenome Family F035811

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F035811
Family Type	Metagenome
Number of Sequences	171
Average Sequence Length	39 residues
Representative Sequence	FGGFFNQGLPLEAGTYQVKLSVGGKDYTTKVVVENDPGM
Number of Associated Samples	140
Number of Associated Scaffolds	171

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	0.58 %
% of genes near scaffold ends (potentially truncated)	99.42 %
% of genes from short scaffolds (< 2000 bps)	89.47 %
Associated GOLD sequencing projects	128
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.48

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (83.041 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (11.111 % of family members)
Environment Ontology (ENVO)	Unclassified (49.708 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (65.497 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 4.48% β-sheet: 26.87% Coil/Unstructured: 68.66%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.48
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.48
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 171 Family Scaffolds
PF10672	Methyltrans_SAM	39.18
PF13847	Methyltransf_31	15.20
PF00583	Acetyltransf_1	8.19
PF01642	MM_CoA_mutase	4.09
PF13620	CarboxypepD_reg	4.09
PF03009	GDPD	1.17
PF01351	RNase_HII	1.17
PF04255	DUF433	0.58
PF03544	TonB_C	0.58
PF03631	Virul_fac_BrkB	0.58
PF13432	TPR_16	0.58
PF04545	Sigma70_r4	0.58
PF02954	HTH_8	0.58
PF13376	OmdA	0.58

COG ID	Name	Functional Category	% Frequency in 171 Family Scaffolds
COG1884	Methylmalonyl-CoA mutase, N-terminal domain/subunit	Lipid transport and metabolism [I]	4.09
COG0164	Ribonuclease HII	Replication, recombination and repair [L]	1.17
COG0584	Glycerophosphoryl diester phosphodiesterase	Lipid transport and metabolism [I]	1.17
COG1039	Ribonuclease HIII	Replication, recombination and repair [L]	1.17
COG0810	Periplasmic protein TonB, links inner and outer membranes	Cell wall/membrane/envelope biogenesis [M]	0.58
COG1295	Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase)	Function unknown [S]	0.58
COG2442	Predicted antitoxin component of a toxin-antitoxin system, DUF433 family	Defense mechanisms [V]	0.58

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	83.04 %
Unclassified	root	N/A	16.96 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	83.04 %
Unclassified	root	N/A	16.96 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	83.04 %
Unclassified	root	N/A	16.96 %

Name	Rank	Taxonomy	Distribution
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	32.16 %
Unclassified	root	N/A	16.96 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1.75 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	1.17 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	1.17 %
Nitrospirae	phylum	All Organisms → cellular organisms → Bacteria → Nitrospirae	0.58 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	16.96 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	7.60 %
Blastocatellia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia	6.43 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	1.17 %
Nitrospira	class	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira	0.58 %
Gemmatimonadetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	0.58 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	0.58 %
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	0.58 %
Armatimonadetes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes	0.58 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.58 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	16.96 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	7.60 %
Blastocatellales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales	5.85 %
Clostridia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia	1.17 %
Fimbriimonadia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → Fimbriimonadia	0.58 %
unclassified Blastocatellia	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia	0.58 %
unclassified Gemmatimonadetes	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes	0.58 %
Nitrospirales	order	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales	0.58 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	0.58 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.58 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.58 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	16.96 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	7.60 %
Pyrinomonadaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae	5.85 %
Fimbriimonadales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → Fimbriimonadia → Fimbriimonadales	0.58 %
Gemmatimonadetes bacterium SCN 70-22	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium SCN 70-22	0.58 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	0.58 %
Eubacteriales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales	0.58 %
unclassified Bacteroidetes	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes	0.58 %
Myxococcales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales	0.58 %
Nitrospirales	order	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales	0.58 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.58 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	16.96 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	7.60 %
Pyrinomonas	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas	5.85 %
Bacteroidetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	0.58 %
Fimbriimonadaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → Fimbriimonadia → Fimbriimonadales → Fimbriimonadaceae	0.58 %
Peptococcaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Peptococcaceae	0.58 %
Gemmatimonadetes bacterium SCN 70-22	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium SCN 70-22	0.58 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	0.58 %
Myxococcales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales	0.58 %
Nitrospirales	order	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales	0.58 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.58 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	16.96 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	7.60 %
Pyrinomonas methylaliphatogenes	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	5.85 %
Fimbriimonas	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → Fimbriimonadia → Fimbriimonadales → Fimbriimonadaceae → Fimbriimonas	0.58 %
Desulfotomaculum	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Peptococcaceae → Desulfotomaculum	0.58 %
Bacteroidetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	0.58 %
Gemmatimonadetes bacterium SCN 70-22	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium SCN 70-22	0.58 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	0.58 %
Myxococcales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales	0.58 %
Nitrospirales	order	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales	0.58 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.58 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	16.96 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	7.60 %
Pyrinomonas methylaliphatogenes	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	5.85 %
Fimbriimonas ginsengisoli	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → Fimbriimonadia → Fimbriimonadales → Fimbriimonadaceae → Fimbriimonas → Fimbriimonas ginsengisoli	0.58 %
Desulfotomaculum	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Peptococcaceae → Desulfotomaculum	0.58 %
Bacteroidetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	0.58 %
Gemmatimonadetes bacterium SCN 70-22	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium SCN 70-22	0.58 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	0.58 %
Myxococcales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales	0.58 %
Nitrospirales	order	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales	0.58 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.58 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2088090014\|GPIPI_16572291	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	15640	Open in IMG/M
2162886007\|SwRhRL2b_contig_2014690	Not Available	1331	Open in IMG/M
3300000559\|F14TC_110577662	Not Available	506	Open in IMG/M
3300000579\|AP72_2010_repI_A01DRAFT_1007078	All Organisms → cellular organisms → Bacteria	1936	Open in IMG/M
3300000893\|AP72_2010_repI_A001DRAFT_1008840	All Organisms → cellular organisms → Bacteria	1808	Open in IMG/M
3300001116\|JGI12627J13344_100006	All Organisms → cellular organisms → Bacteria	40956	Open in IMG/M
3300001431\|F14TB_102459668	All Organisms → cellular organisms → Bacteria → Acidobacteria	1421	Open in IMG/M
3300004016\|Ga0058689_10095624	All Organisms → cellular organisms → Bacteria → Acidobacteria	621	Open in IMG/M
3300004114\|Ga0062593_102748022	All Organisms → cellular organisms → Bacteria → Acidobacteria	561	Open in IMG/M
3300004156\|Ga0062589_102695580	All Organisms → cellular organisms → Bacteria	517	Open in IMG/M
3300004157\|Ga0062590_100740784	All Organisms → cellular organisms → Bacteria	893	Open in IMG/M
3300004268\|Ga0066398_10175159	All Organisms → cellular organisms → Bacteria	552	Open in IMG/M
3300004463\|Ga0063356_100419095	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Peptococcaceae → Desulfotomaculum	1731	Open in IMG/M
3300004480\|Ga0062592_100250093	All Organisms → cellular organisms → Bacteria → Acidobacteria	1299	Open in IMG/M
3300005179\|Ga0066684_10786338	All Organisms → cellular organisms → Bacteria	630	Open in IMG/M
3300005290\|Ga0065712_10053210	All Organisms → cellular organisms → Bacteria → Acidobacteria	641	Open in IMG/M
3300005337\|Ga0070682_101168855	All Organisms → cellular organisms → Bacteria	648	Open in IMG/M
3300005337\|Ga0070682_101743750	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	542	Open in IMG/M
3300005343\|Ga0070687_100070266	All Organisms → cellular organisms → Bacteria	1878	Open in IMG/M
3300005438\|Ga0070701_11297157	All Organisms → cellular organisms → Bacteria	520	Open in IMG/M
3300005440\|Ga0070705_101321694	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → Fimbriimonadia → Fimbriimonadales → Fimbriimonadaceae → Fimbriimonas → Fimbriimonas ginsengisoli	598	Open in IMG/M
3300005444\|Ga0070694_100004083	All Organisms → cellular organisms → Bacteria	8760	Open in IMG/M
3300005459\|Ga0068867_100093944	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia	2280	Open in IMG/M
3300005468\|Ga0070707_102318389	All Organisms → cellular organisms → Bacteria	504	Open in IMG/M
3300005518\|Ga0070699_101418919	All Organisms → cellular organisms → Bacteria → Acidobacteria	637	Open in IMG/M
3300005543\|Ga0070672_100851927	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	803	Open in IMG/M
3300005546\|Ga0070696_101592214	Not Available	561	Open in IMG/M
3300005549\|Ga0070704_101367540	All Organisms → cellular organisms → Bacteria	649	Open in IMG/M
3300005569\|Ga0066705_10724925	Not Available	597	Open in IMG/M
3300005576\|Ga0066708_10322336	All Organisms → cellular organisms → Bacteria	991	Open in IMG/M
3300005577\|Ga0068857_100031769	All Organisms → cellular organisms → Bacteria → Acidobacteria	4666	Open in IMG/M
3300005577\|Ga0068857_102075437	All Organisms → cellular organisms → Bacteria	558	Open in IMG/M
3300005578\|Ga0068854_101868172	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	552	Open in IMG/M
3300005598\|Ga0066706_10417036	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1069	Open in IMG/M
3300005615\|Ga0070702_101705048	All Organisms → cellular organisms → Bacteria	524	Open in IMG/M
3300005616\|Ga0068852_101019230	All Organisms → cellular organisms → Bacteria → Acidobacteria	847	Open in IMG/M
3300005617\|Ga0068859_100191527	All Organisms → cellular organisms → Bacteria	2129	Open in IMG/M
3300005617\|Ga0068859_100373294	All Organisms → cellular organisms → Bacteria	1522	Open in IMG/M
3300005618\|Ga0068864_100978640	Not Available	838	Open in IMG/M
3300005618\|Ga0068864_101776730	All Organisms → cellular organisms → Bacteria → Acidobacteria	622	Open in IMG/M
3300005713\|Ga0066905_101194562	All Organisms → cellular organisms → Bacteria	680	Open in IMG/M
3300005764\|Ga0066903_105892288	All Organisms → cellular organisms → Bacteria	643	Open in IMG/M
3300005840\|Ga0068870_10022228	Not Available	3115	Open in IMG/M
3300005840\|Ga0068870_10512698	All Organisms → cellular organisms → Bacteria	801	Open in IMG/M
3300005840\|Ga0068870_11057479	All Organisms → cellular organisms → Bacteria → Acidobacteria	581	Open in IMG/M
3300005841\|Ga0068863_100610830	All Organisms → cellular organisms → Bacteria → Acidobacteria	1080	Open in IMG/M
3300005841\|Ga0068863_101859575	All Organisms → cellular organisms → Bacteria	612	Open in IMG/M
3300005843\|Ga0068860_100499120	All Organisms → cellular organisms → Bacteria → Acidobacteria	1215	Open in IMG/M
3300005843\|Ga0068860_100663617	Not Available	1051	Open in IMG/M
3300005844\|Ga0068862_100585175	All Organisms → cellular organisms → Bacteria	1070	Open in IMG/M
3300005844\|Ga0068862_101344783	Not Available	716	Open in IMG/M
3300006237\|Ga0097621_100517634	All Organisms → cellular organisms → Bacteria	1082	Open in IMG/M
3300006794\|Ga0066658_10380497	All Organisms → cellular organisms → Bacteria	761	Open in IMG/M
3300006797\|Ga0066659_10220147	All Organisms → cellular organisms → Bacteria	1402	Open in IMG/M
3300006844\|Ga0075428_101604959	All Organisms → cellular organisms → Bacteria	680	Open in IMG/M
3300006852\|Ga0075433_11854516	Not Available	518	Open in IMG/M
3300006854\|Ga0075425_102397497	All Organisms → cellular organisms → Bacteria	585	Open in IMG/M
3300006904\|Ga0075424_100727973	All Organisms → cellular organisms → Bacteria	1059	Open in IMG/M
3300006904\|Ga0075424_101440189	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	732	Open in IMG/M
3300006918\|Ga0079216_10054072	All Organisms → cellular organisms → Bacteria	1753	Open in IMG/M
3300009012\|Ga0066710_102012073	All Organisms → cellular organisms → Bacteria	856	Open in IMG/M
3300009012\|Ga0066710_103141182	All Organisms → cellular organisms → Bacteria	637	Open in IMG/M
3300009093\|Ga0105240_12432143	All Organisms → cellular organisms → Bacteria → Acidobacteria	542	Open in IMG/M
3300009093\|Ga0105240_12643234	All Organisms → cellular organisms → Bacteria	518	Open in IMG/M
3300009094\|Ga0111539_10587239	All Organisms → cellular organisms → Bacteria	1297	Open in IMG/M
3300009098\|Ga0105245_12270182	All Organisms → cellular organisms → Bacteria	596	Open in IMG/M
3300009100\|Ga0075418_12003502	Not Available	631	Open in IMG/M
3300009101\|Ga0105247_10197826	All Organisms → cellular organisms → Bacteria → Acidobacteria	1349	Open in IMG/M
3300009137\|Ga0066709_102521966	Not Available	692	Open in IMG/M
3300009137\|Ga0066709_102710476	Not Available	660	Open in IMG/M
3300009147\|Ga0114129_12359652	Not Available	638	Open in IMG/M
3300009148\|Ga0105243_10197476	Not Available	1762	Open in IMG/M
3300009148\|Ga0105243_11711378	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	658	Open in IMG/M
3300009162\|Ga0075423_11770621	All Organisms → cellular organisms → Bacteria	666	Open in IMG/M
3300009162\|Ga0075423_12768889	All Organisms → cellular organisms → Bacteria	537	Open in IMG/M
3300009174\|Ga0105241_10442483	All Organisms → cellular organisms → Bacteria → Acidobacteria	1148	Open in IMG/M
3300009174\|Ga0105241_11695566	All Organisms → cellular organisms → Bacteria	614	Open in IMG/M
3300009177\|Ga0105248_10515043	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1349	Open in IMG/M
3300009177\|Ga0105248_11337736	All Organisms → cellular organisms → Bacteria	810	Open in IMG/M
3300010038\|Ga0126315_10943680	All Organisms → cellular organisms → Bacteria	575	Open in IMG/M
3300010045\|Ga0126311_11054455	All Organisms → cellular organisms → Bacteria → Acidobacteria	667	Open in IMG/M
3300010321\|Ga0134067_10419727	All Organisms → cellular organisms → Bacteria	540	Open in IMG/M
3300010359\|Ga0126376_10440849	All Organisms → cellular organisms → Bacteria	1187	Open in IMG/M
3300010362\|Ga0126377_12926426	All Organisms → cellular organisms → Bacteria	551	Open in IMG/M
3300010366\|Ga0126379_11538275	All Organisms → cellular organisms → Bacteria	771	Open in IMG/M
3300010375\|Ga0105239_10286797	All Organisms → cellular organisms → Bacteria	1854	Open in IMG/M
3300010396\|Ga0134126_11209541	All Organisms → cellular organisms → Bacteria	839	Open in IMG/M
3300010397\|Ga0134124_10692125	All Organisms → cellular organisms → Bacteria	1008	Open in IMG/M
3300010399\|Ga0134127_10173791	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	1980	Open in IMG/M
3300010400\|Ga0134122_10513869	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1087	Open in IMG/M
3300010400\|Ga0134122_10554384	Not Available	1052	Open in IMG/M
3300010401\|Ga0134121_10021306	All Organisms → cellular organisms → Bacteria → Acidobacteria	5190	Open in IMG/M
3300010403\|Ga0134123_12970308	All Organisms → cellular organisms → Bacteria → Acidobacteria	543	Open in IMG/M
3300012189\|Ga0137388_10876580	All Organisms → cellular organisms → Bacteria	830	Open in IMG/M
3300012203\|Ga0137399_10916125	All Organisms → cellular organisms → Bacteria	738	Open in IMG/M
3300012204\|Ga0137374_10772154	Not Available	715	Open in IMG/M
3300012206\|Ga0137380_11475368	Not Available	565	Open in IMG/M
3300012207\|Ga0137381_10583171	All Organisms → cellular organisms → Bacteria	974	Open in IMG/M
3300012210\|Ga0137378_10366738	All Organisms → cellular organisms → Bacteria → Acidobacteria	1338	Open in IMG/M
3300012211\|Ga0137377_11256202	Not Available	671	Open in IMG/M
3300012285\|Ga0137370_11024735	All Organisms → cellular organisms → Bacteria	508	Open in IMG/M
3300012350\|Ga0137372_10266227	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	1342	Open in IMG/M
3300012363\|Ga0137390_10049958	All Organisms → cellular organisms → Bacteria	4054	Open in IMG/M
3300012683\|Ga0137398_10145754	All Organisms → cellular organisms → Bacteria	1533	Open in IMG/M
3300012912\|Ga0157306_10246443	Not Available	628	Open in IMG/M
3300012917\|Ga0137395_10611922	All Organisms → cellular organisms → Bacteria	787	Open in IMG/M
3300012923\|Ga0137359_10187079	All Organisms → cellular organisms → Bacteria → Acidobacteria	1850	Open in IMG/M
3300012927\|Ga0137416_10866699	All Organisms → cellular organisms → Bacteria	802	Open in IMG/M
3300012927\|Ga0137416_11914324	All Organisms → cellular organisms → Bacteria	543	Open in IMG/M
3300012944\|Ga0137410_10353379	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1175	Open in IMG/M
3300012960\|Ga0164301_10828815	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	710	Open in IMG/M
3300012961\|Ga0164302_11725903	Not Available	526	Open in IMG/M
3300012975\|Ga0134110_10434525	Not Available	587	Open in IMG/M
3300013100\|Ga0157373_10393248	All Organisms → cellular organisms → Bacteria	993	Open in IMG/M
3300013297\|Ga0157378_12016449	All Organisms → cellular organisms → Bacteria	627	Open in IMG/M
3300013306\|Ga0163162_10342502	All Organisms → cellular organisms → Bacteria	1627	Open in IMG/M
3300013306\|Ga0163162_10345696	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales	1620	Open in IMG/M
3300013306\|Ga0163162_10346172	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	1619	Open in IMG/M
3300013306\|Ga0163162_10676076	All Organisms → cellular organisms → Bacteria → Acidobacteria	1155	Open in IMG/M
3300013307\|Ga0157372_10015855	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	8083	Open in IMG/M
3300014325\|Ga0163163_10120165	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	2661	Open in IMG/M
3300014745\|Ga0157377_10379871	All Organisms → cellular organisms → Bacteria	956	Open in IMG/M
3300015069\|Ga0167633_109640	All Organisms → cellular organisms → Bacteria → Acidobacteria	1269	Open in IMG/M
3300015077\|Ga0173483_10872777	All Organisms → cellular organisms → Bacteria	527	Open in IMG/M
3300015078\|Ga0167660_1025666	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	651	Open in IMG/M
3300015262\|Ga0182007_10051944	All Organisms → cellular organisms → Bacteria → Acidobacteria	1351	Open in IMG/M
3300015372\|Ga0132256_102381468	All Organisms → cellular organisms → Bacteria	632	Open in IMG/M
3300015372\|Ga0132256_103135582	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	556	Open in IMG/M
3300015373\|Ga0132257_100590089	Not Available	1372	Open in IMG/M
3300015373\|Ga0132257_101385660	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	894	Open in IMG/M
3300015374\|Ga0132255_104862476	All Organisms → cellular organisms → Bacteria	569	Open in IMG/M
3300016341\|Ga0182035_11031202	All Organisms → cellular organisms → Bacteria	730	Open in IMG/M
3300018482\|Ga0066669_10105610	All Organisms → cellular organisms → Bacteria	1968	Open in IMG/M
3300019458\|Ga0187892_10308952	Not Available	785	Open in IMG/M
3300020062\|Ga0193724_1050295	Not Available	882	Open in IMG/M
3300024224\|Ga0247673_1001116	All Organisms → cellular organisms → Bacteria	3120	Open in IMG/M
3300025885\|Ga0207653_10047064	All Organisms → cellular organisms → Bacteria	1427	Open in IMG/M
3300025904\|Ga0207647_10528137	All Organisms → cellular organisms → Bacteria → Acidobacteria	656	Open in IMG/M
3300025908\|Ga0207643_10256088	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1079	Open in IMG/M
3300025923\|Ga0207681_11056690	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	682	Open in IMG/M
3300025924\|Ga0207694_10110186	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	2190	Open in IMG/M
3300025925\|Ga0207650_11005809	All Organisms → cellular organisms → Bacteria → Acidobacteria	709	Open in IMG/M
3300025925\|Ga0207650_11737875	All Organisms → cellular organisms → Bacteria	528	Open in IMG/M
3300025930\|Ga0207701_10049754	All Organisms → cellular organisms → Bacteria	3859	Open in IMG/M
3300025932\|Ga0207690_11585298	All Organisms → cellular organisms → Bacteria → Acidobacteria	547	Open in IMG/M
3300025935\|Ga0207709_11258218	All Organisms → cellular organisms → Bacteria → Acidobacteria	611	Open in IMG/M
3300025936\|Ga0207670_11807200	All Organisms → cellular organisms → Bacteria	520	Open in IMG/M
3300025940\|Ga0207691_10282391	All Organisms → cellular organisms → Bacteria	1428	Open in IMG/M
3300025941\|Ga0207711_10046109	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	3725	Open in IMG/M
3300025941\|Ga0207711_10143552	All Organisms → cellular organisms → Bacteria	2149	Open in IMG/M
3300026089\|Ga0207648_10138183	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	2147	Open in IMG/M
3300026089\|Ga0207648_10432104	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1197	Open in IMG/M
3300026089\|Ga0207648_10637374	Not Available	984	Open in IMG/M
3300026142\|Ga0207698_10975528	All Organisms → cellular organisms → Bacteria → Acidobacteria	857	Open in IMG/M
3300026538\|Ga0209056_10394129	All Organisms → cellular organisms → Bacteria	860	Open in IMG/M
3300027266\|Ga0209215_1023935	All Organisms → cellular organisms → Bacteria → Acidobacteria	799	Open in IMG/M
3300027691\|Ga0209485_1032123	All Organisms → cellular organisms → Bacteria → Acidobacteria	1269	Open in IMG/M
3300027775\|Ga0209177_10176304	All Organisms → cellular organisms → Bacteria	744	Open in IMG/M
3300027815\|Ga0209726_10245514	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales	909	Open in IMG/M
3300027873\|Ga0209814_10396340	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium SCN 70-22	607	Open in IMG/M
3300027907\|Ga0207428_10117275	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	2044	Open in IMG/M
3300028380\|Ga0268265_10451881	Not Available	1200	Open in IMG/M
3300028381\|Ga0268264_10618521	Not Available	1069	Open in IMG/M
3300028381\|Ga0268264_11305699	All Organisms → cellular organisms → Bacteria	736	Open in IMG/M
3300028536\|Ga0137415_11286062	All Organisms → cellular organisms → Bacteria	549	Open in IMG/M
3300028536\|Ga0137415_11481031	Not Available	504	Open in IMG/M
3300028536\|Ga0137415_11483351	Not Available	503	Open in IMG/M
3300028792\|Ga0307504_10350946	All Organisms → cellular organisms → Bacteria	568	Open in IMG/M
3300031901\|Ga0307406_11699055	All Organisms → cellular organisms → Bacteria	559	Open in IMG/M
3300031911\|Ga0307412_11471842	All Organisms → cellular organisms → Bacteria → Acidobacteria	618	Open in IMG/M
3300032180\|Ga0307471_104043386	All Organisms → cellular organisms → Bacteria	518	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	52.05%
Host-Associated	Host-Associated	47.95%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	51.46%
Plants	Host-Associated → Plants	47.95%
Aquatic	Environmental → Aquatic	0.58%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	50.88%
Rhizosphere	Host-Associated → Plants → Rhizosphere	24.56%
Rhizoplane	Host-Associated → Plants → Rhizoplane	21.64%
Roots	Host-Associated → Plants → Roots	1.17%
Freshwater	Environmental → Aquatic → Freshwater	0.58%
Cave	Environmental → Terrestrial → Cave	0.58%
Phyllosphere	Host-Associated → Plants → Phyllosphere	0.58%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	39.18%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	19.88%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	18.71%
Loam	Environmental → Terrestrial → Soil → Loam	11.70%
Soil	Host-Associated → Plants → Rhizosphere → Soil	4.68%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	2.92%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	1.17%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	0.58%
Unclassified	Environmental → Terrestrial → Cave → Unclassified	0.58%
Phylloplane/Leaf Surface	Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface	0.58%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	23.98%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	19.88%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	18.71%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	8.19%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	7.60%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	4.68%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	4.09%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	2.92%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	2.92%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	2.92%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	1.17%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	1.17%
Contaminated	Environmental → Aquatic → Freshwater → Groundwater → Contaminated	0.58%
Unclassified	Environmental → Terrestrial → Cave → Unclassified → Unclassified	0.58%
Unclassified	Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified	0.58%

Habitat	Taxonomy	Distribution
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	11.11%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	7.60%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	7.02%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	5.26%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	4.68%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	4.68%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	4.09%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	3.51%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	3.51%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	3.51%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	2.34%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	2.34%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	2.34%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	2.92%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	2.92%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	1.75%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	1.75%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	1.75%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	1.75%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	1.75%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	1.17%
Glacier Forefield Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil	1.17%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	1.17%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	1.17%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	1.17%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	1.17%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	1.17%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	1.17%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	1.17%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	1.17%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.17%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	1.17%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	1.17%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater	0.58%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere	0.58%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.58%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.58%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	0.58%
Bio-Ooze	Environmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze	0.58%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere	0.58%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere	0.58%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	0.58%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	0.58%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	0.58%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	0.58%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	0.58%
Agave	Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave	0.58%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2088090014	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
2162886007	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2	Host-Associated	Open in IMG/M
3300000559	Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly	Environmental	Open in IMG/M
3300000579	Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A01	Environmental	Open in IMG/M
3300000893	Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A001	Environmental	Open in IMG/M
3300001116	Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M2	Environmental	Open in IMG/M
3300001431	Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly	Environmental	Open in IMG/M
3300004016	Agave microbial communities from Guanajuato, Mexico - As.Ma.rz	Host-Associated	Open in IMG/M
3300004114	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5	Environmental	Open in IMG/M
3300004156	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1	Environmental	Open in IMG/M
3300004157	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2	Environmental	Open in IMG/M
3300004268	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio	Environmental	Open in IMG/M
3300004463	Combined assembly of Arabidopsis thaliana microbial communities	Host-Associated	Open in IMG/M
3300004480	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4	Environmental	Open in IMG/M
3300005179	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133	Environmental	Open in IMG/M
3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1	Host-Associated	Open in IMG/M
3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Environmental	Open in IMG/M
3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Environmental	Open in IMG/M
3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Environmental	Open in IMG/M
3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Environmental	Open in IMG/M
3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Environmental	Open in IMG/M
3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Host-Associated	Open in IMG/M
3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Environmental	Open in IMG/M
3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Environmental	Open in IMG/M
3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Host-Associated	Open in IMG/M
3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Environmental	Open in IMG/M
3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Environmental	Open in IMG/M
3300005569	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154	Environmental	Open in IMG/M
3300005576	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157	Environmental	Open in IMG/M
3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Host-Associated	Open in IMG/M
3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Host-Associated	Open in IMG/M
3300005598	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155	Environmental	Open in IMG/M
3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Environmental	Open in IMG/M
3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Host-Associated	Open in IMG/M
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated	Open in IMG/M
3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Host-Associated	Open in IMG/M
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Host-Associated	Open in IMG/M
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated	Open in IMG/M
3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Host-Associated	Open in IMG/M
3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Host-Associated	Open in IMG/M
3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)	Host-Associated	Open in IMG/M
3300006794	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107	Environmental	Open in IMG/M
3300006797	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108	Environmental	Open in IMG/M
3300006844	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Host-Associated	Open in IMG/M
3300006852	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Host-Associated	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated	Open in IMG/M
3300006918	Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100	Environmental	Open in IMG/M
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental	Open in IMG/M
3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Host-Associated	Open in IMG/M
3300009094	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)	Host-Associated	Open in IMG/M
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated	Open in IMG/M
3300009100	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2	Host-Associated	Open in IMG/M
3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Host-Associated	Open in IMG/M
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental	Open in IMG/M
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated	Open in IMG/M
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Host-Associated	Open in IMG/M
3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Host-Associated	Open in IMG/M
3300010038	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106	Environmental	Open in IMG/M
3300010045	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61	Environmental	Open in IMG/M
3300010321	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015	Environmental	Open in IMG/M
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Host-Associated	Open in IMG/M
3300010396	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2	Environmental	Open in IMG/M
3300010397	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4	Environmental	Open in IMG/M
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental	Open in IMG/M
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental	Open in IMG/M
3300010401	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1	Environmental	Open in IMG/M
3300010403	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3	Environmental	Open in IMG/M
3300012189	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG	Environmental	Open in IMG/M
3300012203	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG	Environmental	Open in IMG/M
3300012204	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG	Environmental	Open in IMG/M
3300012206	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG	Environmental	Open in IMG/M
3300012207	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG	Environmental	Open in IMG/M
3300012210	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG	Environmental	Open in IMG/M
3300012211	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG	Environmental	Open in IMG/M
3300012285	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG	Environmental	Open in IMG/M
3300012350	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG	Environmental	Open in IMG/M
3300012363	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG	Environmental	Open in IMG/M
3300012683	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG	Environmental	Open in IMG/M
3300012912	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2	Environmental	Open in IMG/M
3300012917	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG	Environmental	Open in IMG/M
3300012923	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG	Environmental	Open in IMG/M
3300012927	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012944	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012960	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG	Environmental	Open in IMG/M
3300012961	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG	Environmental	Open in IMG/M
3300012975	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015	Environmental	Open in IMG/M
3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Host-Associated	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Host-Associated	Open in IMG/M
3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Host-Associated	Open in IMG/M
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated	Open in IMG/M
3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Host-Associated	Open in IMG/M
3300015069	Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G4C, Ice margin, adjacent to proglacial lake	Environmental	Open in IMG/M
3300015077	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)	Environmental	Open in IMG/M
3300015078	Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-11a, vegetated hydrological feature)	Environmental	Open in IMG/M
3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Host-Associated	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300016341	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170	Environmental	Open in IMG/M
3300018482	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118	Environmental	Open in IMG/M
3300019458	Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaG	Environmental	Open in IMG/M
3300020062	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1	Environmental	Open in IMG/M
3300024224	Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK14	Environmental	Open in IMG/M
3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)	Host-Associated	Open in IMG/M
3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025930	Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)	Environmental	Open in IMG/M
3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)	Environmental	Open in IMG/M
3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026538	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)	Environmental	Open in IMG/M
3300027266	Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M2 (SPAdes)	Environmental	Open in IMG/M
3300027691	Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 (SPAdes)	Environmental	Open in IMG/M
3300027775	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)	Environmental	Open in IMG/M
3300027815	Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes)	Environmental	Open in IMG/M
3300027873	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)	Host-Associated	Open in IMG/M
3300027907	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)	Host-Associated	Open in IMG/M
3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028536	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300028792	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S	Environmental	Open in IMG/M
3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Host-Associated	Open in IMG/M
3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Host-Associated	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
GPIPI_01094530	2088090014	Soil	GGGFGGFFNQGLPLEAGTYQVKLSVGGKDYTTKVVVXXXXXX
SwRhRL2b_0696.00008340	2162886007	Switchgrass Rhizosphere	FLNLGLPLEAGTYNLKLTVGGKDYTTKIVIENDPGM
F14TC_1105776622	3300000559	Soil	FFNIGPALEPGTYAVKLSVNGKEYTTKAVIESDPGMIP*
AP72_2010_repI_A01DRAFT_10070783	3300000579	Forest Soil	GGGGFGGGFNLGPPLEAGTYQVKLSVNGKEYTTKAVIENDPGIQP*
AP72_2010_repI_A001DRAFT_10088401	3300000893	Forest Soil	GGGFGGGFNLGPPLEAGTYQVKLSVNGKEYTTKAVIENDPGIQP*
JGI12627J13344_10000631	3300001116	Forest Soil	GGLNQGLPLEAGTYQLKLSAGGKDLTTKLVIENDPGIN*
F14TB_1024596682	3300001431	Soil	GGFANLGLPLEAGTYQVKLTVNGKDYTTKAVIENDPGLN*
Ga0058689_100956242	3300004016	Agave	GGGGFGGFAQGLPLEAGTYVVKMSVGGKDYTTRVVIENDPGIN*
Ga0062593_1027480222	3300004114	Soil	FGGAFNQGLPLEAGTYNLKLTIGGKEYKTKIVVENDPGLN*
Ga0062589_1026955801	3300004156	Soil	GGFGGLFNLGLPLEAGTYNLKLTVGGKEYKTKVVIENDPGF*
Ga0062590_1007407841	3300004157	Soil	GGGGFGNIFNQGLPLEAGTYNLKLTVNGKDYTTKVVIENDPGF*
Ga0066398_101751591	3300004268	Tropical Forest Soil	GGGFAGLFNLGPVIDPGTYVVKLSVNGKELSTKVLVEADPGMTP*
Ga0063356_1004190953	3300004463	Arabidopsis Thaliana Rhizosphere	GGGFGNIFNQGLPLEAGTYNLKLTVNGKDYTTKVVLEPDPGFN*
Ga0062592_1002500931	3300004480	Soil	GGGFGNIFNQGLPLEAGTYNLKLTVNGKDYTTKVVIENDPGFN*
Ga0066684_107863381	3300005179	Soil	GGGGGFAALFNQGPLVEPGTYVLKLSVGGKEYTTKVMVEADTWMNQ*
Ga0065712_100532102	3300005290	Miscanthus Rhizosphere	GFFNQGLPLEAGTYLVKLSVGGKDYTTKVVIENDPGLTP*
Ga0070682_1011688551	3300005337	Corn Rhizosphere	GGGFGGFLNQGLPLEAGTYNLKLTVGGKDYTTKIVVENDPGM*
Ga0070682_1017437501	3300005337	Corn Rhizosphere	GGFGGFNLGLPLEAGTYQVKLTVNGKDYTTRVVIENDPGM*
Ga0070687_1000702661	3300005343	Switchgrass Rhizosphere	FGGFNLGLPLEAGTYNLKLSVGGKEYATKIVVENDPGLQP*
Ga0070701_112971572	3300005438	Corn, Switchgrass And Miscanthus Rhizosphere	GGGFGGLFNLGLPLEAGTYNLKLSVNGKDYTTKVVIENDPGIN*
Ga0070705_1013216941	3300005440	Corn, Switchgrass And Miscanthus Rhizosphere	VLDRLFQGGGFGGFFNIGPIIDPGTYNLKLSVNGKEYTTKVVIETDPGMQP*
Ga0070694_1000040831	3300005444	Corn, Switchgrass And Miscanthus Rhizosphere	GGFNFGTVLEPGTYAVKLSVNGKEYVTKAVIESDPGMIP*
Ga0068867_1000939441	3300005459	Miscanthus Rhizosphere	GFGGLFNLGLPLEAGTYNLKLSVNGKDYTTKVVIENDPGIN*
Ga0070707_1023183892	3300005468	Corn, Switchgrass And Miscanthus Rhizosphere	GGGFGGFLNQGLPLEAGTYNLKLTVGGKDYTTKIVVENDPGL*
Ga0070699_1014189192	3300005518	Corn, Switchgrass And Miscanthus Rhizosphere	GGGFGGLFNLGLPLEAGTYNLKLTVNGKDYTTKVVIENDPGFN*
Ga0070672_1008519271	3300005543	Miscanthus Rhizosphere	GGGFGGFNLGLPLEAGTYQVKLTVNGKDYTTRVVIENDPGM*
Ga0070696_1015922142	3300005546	Corn, Switchgrass And Miscanthus Rhizosphere	GGFGGLFNIGPVVEPGPYQMKLSVNGKDYTTKVVVEADPGIQP*
Ga0070704_1013675401	3300005549	Corn, Switchgrass And Miscanthus Rhizosphere	GGGGGGFGNLFNLGLPLEAGTYNLKLTVGGKDYTTKVVIENDPGL*
Ga0066705_107249251	3300005569	Soil	FAGPALDAGTYYLKLSVNGKDFTTKVVVENDPGMQP*
Ga0066708_103223361	3300005576	Soil	GPLLEPGTYNVKLSMNGKDYTTKAVIEVDPGMQP*
Ga0068857_1000317691	3300005577	Corn Rhizosphere	GFGGFFNQGLPLEAGTYNLKLTVGGKDYTTKIVVENDPGQ*
Ga0068857_1020754372	3300005577	Corn Rhizosphere	GGGFGGAFNQGLPLEAGTYNLKLSVGGKDYTTKIVIENDPGM*
Ga0068854_1018681722	3300005578	Corn Rhizosphere	GLFNLGPALEAGTYAVKMSVNGKDYTTKVVIEPDPGMMP*
Ga0066706_104170361	3300005598	Soil	NLGAPLEAGVYNLKLSVGGKDYTTKVVIENDPGAN*
Ga0070702_1017050481	3300005615	Corn, Switchgrass And Miscanthus Rhizosphere	GGFGNVFTQGLPLEAGTYNLKLTVGGKDYTTKIVVENDPGF*
Ga0068852_1010192302	3300005616	Corn Rhizosphere	NQGLPLEAGTYNLKLSVGGKDYTTKIVIENDPGL*
Ga0068859_1001915273	3300005617	Switchgrass Rhizosphere	LGLPLEAGTYNLKLSVGGKEYATKIVVENDPGLQP*
Ga0068859_1003732941	3300005617	Switchgrass Rhizosphere	GGGFGGGFNLGLPLEAGTYVVKLSVGGKDYTTKVVIENDPGVN*
Ga0068864_1009786402	3300005618	Switchgrass Rhizosphere	GPALEPGTYAVKLSVNGKEYITKAVIESDPGMIP*
Ga0068864_1017767302	3300005618	Switchgrass Rhizosphere	GLPLEAGTYLVKLSVGGKDYTTKVVIENDPGLTP*
Ga0066905_1011945621	3300005713	Tropical Forest Soil	GGFFNLGPALEPGTYAVKVSVNGKDYTTKVVIESDPGMTP*
Ga0066903_1058922881	3300005764	Tropical Forest Soil	GGGFGRFFNLGPPVEPGTYTIKVQVGDKEYMTKVVVEADPGVNE*
Ga0068870_100222284	3300005840	Miscanthus Rhizosphere	FAQGLPLEAGTYNLKLIVGGKDYTTKVVIENDPGM*
Ga0068870_105126981	3300005840	Miscanthus Rhizosphere	FAQGLPLEAGTYVVKLSVGGKDYTQKVVIENDPGVN*
Ga0068870_110574791	3300005840	Miscanthus Rhizosphere	GGGGGFGNVFTQGLPLEAGTYNLTLSVGGKEYKTKIVVENDPGM*
Ga0068863_1006108302	3300005841	Switchgrass Rhizosphere	NQGLPLEAGTYNLKLTVGGKDYTTKIVVENDPGQ*
Ga0068863_1018595751	3300005841	Switchgrass Rhizosphere	GGGFGGFNLGLPLEAGTYVVKLSVGGKDYTTKVVIENDPGVN*
Ga0068860_1004991201	3300005843	Switchgrass Rhizosphere	GGFGGLFNQGLPLEAGTYNLKLSVGGKDYTTKIVVENDPGL*
Ga0068860_1006636172	3300005843	Switchgrass Rhizosphere	GFGGFNLGLPLEAGTYNLKLSVGGKEYATKIVVENDPGLQP*
Ga0068862_1005851753	3300005844	Switchgrass Rhizosphere	GFNLGLPLEAGTYQVKLTVNGKDYTTRVVIENDPGM*
Ga0068862_1013447832	3300005844	Switchgrass Rhizosphere	GFGNLFNQGLPLEAGTYNLKLSVGGKDYTTKIVIENDPGL*
Ga0097621_1005176343	3300006237	Miscanthus Rhizosphere	FNLGLPLEAGTYQVKLTVNGKDYTTRVVIENDPGM*
Ga0066658_103804972	3300006794	Soil	FNLGPLLEPGTYNVKLSVNGKDYTTKAVIEVDPGMQP*
Ga0066659_102201473	3300006797	Soil	FFNLGPVIDPGAYNVKLSVNGKDYTTKVVEEADPGMQP*
Ga0075428_1016049592	3300006844	Populus Rhizosphere	LNQGLPLEAGTYLVKLSVGGKDYTTKVVIENDPGLN*
Ga0075433_118545161	3300006852	Populus Rhizosphere	GFGGIFNQGLPVEPGTYVVKVSIGGKEYTTKVIVEADTWMGQ*
Ga0075425_1023974973	3300006854	Populus Rhizosphere	LGPVIEPGTYNVKLSVNGKDYTTKVVVEADPGMQP*
Ga0075424_1007279732	3300006904	Populus Rhizosphere	FGGFLNQGLPLEAGTYNLKLIVGGKEYITKIVVENDPGIQP*
Ga0075424_1014401892	3300006904	Populus Rhizosphere	GFNLGPQLEAGTYQVKLTVGGKDYSTRVVIENDPGM*
Ga0079216_100540721	3300006918	Agricultural Soil	IFTQGLPLEAGTYNLKLTVNGKDYTTKVVIENDPGFN*
Ga0066710_1020120733	3300009012	Grasslands Soil	GCGGGGLCGFSNRGPLLESGTYSVKLSMNGKEYTTKAVIEVDPGMQP
Ga0066710_1031411821	3300009012	Grasslands Soil	GLNLGRPLEAGTYQVKLSVDGKDSTTKAVIENDPGMQP
Ga0105240_124321432	3300009093	Corn Rhizosphere	FNQGLPLEAGTYNLKLSVGGKDYTTKIVIENDPGMNP*
Ga0105240_126432341	3300009093	Corn Rhizosphere	GGGFNLGLPLEPGTYNVKLSVGGKDYTTKVVIEPDPGM*
Ga0111539_105872393	3300009094	Populus Rhizosphere	GFGGLFNLGLPLEAGTYQVKLSVGGKDYTTKVVVENDPGM*
Ga0105245_122701821	3300009098	Miscanthus Rhizosphere	AQGLPLEAGTYNVTLTVNGKDYKTKVVVENDPGLN*
Ga0075418_120035021	3300009100	Populus Rhizosphere	NIGLPLEAGTYQVKLSVGGKDFTTKAVLENDPGM*
Ga0105247_101978261	3300009101	Switchgrass Rhizosphere	NLFNQGLPLEAGTYNLKLSVGGKDYTTKIVIENDPGLQ*
Ga0066709_1025219661	3300009137	Grasslands Soil	GCFGGFFTVGRAIDAGTYYLKLSVKGKEYTTKVVIEPDPGMQF*
Ga0066709_1027104762	3300009137	Grasslands Soil	FGGFFNLGPLLEPGTYNVKLSMNGKDYTTKAVIEVDPGMQP*
Ga0114129_123596522	3300009147	Populus Rhizosphere	GGFGGLNLGLPLEAGTYQVKLTVGGKDYLTRVIIENDPGM*
Ga0105243_101974763	3300009148	Miscanthus Rhizosphere	GGGFGGLFNLGLPLEAGTYNVKLSVNGKDYTTKAVIENDPGMN*
Ga0105243_117113781	3300009148	Miscanthus Rhizosphere	GLFNIGPPLDAGTYVLKLTVGGKEFTTKAVIEADVPLVP*
Ga0075423_117706212	3300009162	Populus Rhizosphere	QGPLLDPGTYNVKLSGNGKDYTTKVVVEADPGMQP*
Ga0075423_127688892	3300009162	Populus Rhizosphere	GALLEPGTYNVKLSVNGKDYTTKVVVEADPGMQP*
Ga0105241_104424832	3300009174	Corn Rhizosphere	FGGFFNQGLPLEAGTYNLKLTVGGKDYTTKIVVENDPGM*
Ga0105241_116955662	3300009174	Corn Rhizosphere	GGGGFGGFLNQGLPLEAGTYNLKLTVGGKDYTTKIVIENDPGMN*
Ga0105248_105150431	3300009177	Switchgrass Rhizosphere	GFGGFNLGLPLEAGTYQVKLTVNGKDYTTRVVIENDPGM*
Ga0105248_113377362	3300009177	Switchgrass Rhizosphere	GGFNFGPALEAGTYQVKLTVNGKDYTTRAVIENDPGMGP*
Ga0126315_109436802	3300010038	Serpentine Soil	GNIFTQGLPLEAGTYNLKLTVGGKDHTTKIVVENDPGM*
Ga0126311_110544551	3300010045	Serpentine Soil	NLGLPLEAGTYNLKLSVGGKDYTTKVVIENDPGLN*
Ga0134067_104197272	3300010321	Grasslands Soil	NLGPVIEPGTYNVKLSVNGKDYATKVVVETDPGMQP*
Ga0126376_104408493	3300010359	Tropical Forest Soil	FGGFNLGLPLEAGTYQVKLSVGGKDYTTKAVIENDPGMN*
Ga0126377_129264261	3300010362	Tropical Forest Soil	GLFNLGLPLEAGTYNVKLTVNGKDYTTKAVIENDPGM*
Ga0126379_115382753	3300010366	Tropical Forest Soil	FGGGFNFGAPLEAGTYQVKLTVNGKDYATKAVIENDPGIQP*
Ga0105239_102867974	3300010375	Corn Rhizosphere	FNQGLPLEAGTYQVKLSVGGKDYTTKVVVENDPGM*
Ga0134126_112095412	3300010396	Terrestrial Soil	LFNLGLPLEAGTYNVKLTVNGKDYTTKVVVENDPGM*
Ga0134124_106921252	3300010397	Terrestrial Soil	FGGFFAQGLPLEAGTYNVTLTVKGKDYKTKVVVENDPGL*
Ga0134127_101737913	3300010399	Terrestrial Soil	FGGAFNIGLPLEAGTYNLKLSVGGKDYTTKVVIENDPGL*
Ga0134122_105138691	3300010400	Terrestrial Soil	GFNLGPQLEAGTYQVKLSVGGKDYSTRVVIENDPGM*
Ga0134122_105543841	3300010400	Terrestrial Soil	VFTQGLPLEAGTYNLKLTVGGKDYTTKIVVENDPGF*
Ga0134121_100213065	3300010401	Terrestrial Soil	GGGGFGGLFNQGLPLEAGTYNLKLSVGGKDYTTKVVIENDPGL*
Ga0134123_129703082	3300010403	Terrestrial Soil	GFGGFFNQGLPLEAGTYNLKLSVGGKDYTTKIVVENDPGL*
Ga0137388_108765802	3300012189	Vadose Zone Soil	GGFFNFGPAIEPGTYNLKLSVNGKDYTTKVVIETDPGMQF*
Ga0137399_109161251	3300012203	Vadose Zone Soil	GFGGFFNVGPVIEPGTYAVKLSVNGKDYTTKVIVEADPGILP*
Ga0137374_107721542	3300012204	Vadose Zone Soil	GGFGGFFNTGPAIDAGTYNVKLSVNGKDYTTKVVVEADPGMQP*
Ga0137380_114753682	3300012206	Vadose Zone Soil	GPVIEPGTYNVKLSVNGKDYTTKVVVETDPGMTP*
Ga0137381_105831712	3300012207	Vadose Zone Soil	SNVGPVIEPGTYAVKLSVNGKDYTTKVIVEADPGMLP*
Ga0137378_103667381	3300012210	Vadose Zone Soil	GFFNLGPVIEPGTYNVKLSVNGKDYATKVVVETDPGMQP*
Ga0137377_112562021	3300012211	Vadose Zone Soil	GGFGGLFNLGLPVEPGTYTVKLSVGGKDYTTKVIVEADTWMGQ*
Ga0137370_110247352	3300012285	Vadose Zone Soil	GGLRNINTKIEPGTHAVKLSVNGKDYTTKVVVEADPGMLP*
Ga0137372_102662273	3300012350	Vadose Zone Soil	GFGGLFGGPALEAGTYYLKLSVDGKDYTTKVVIENDPGMQP*
Ga0137390_100499584	3300012363	Vadose Zone Soil	GFFNLGPVIEPGTYAVKLSANGKDYTTKVIVEADPGMLP*
Ga0137398_101457542	3300012683	Vadose Zone Soil	GGGGFGGFFNIGPAFDPGTYFLKLSVNGKDYTTKVVIETDPGM*
Ga0157306_102464431	3300012912	Soil	FNLGLPLEAGTYNLKLSVNGKDYTTKVVIENDPGIN*
Ga0137395_106119221	3300012917	Vadose Zone Soil	FGGPALEAGTYYLKLSVNGKDYTTKVVVENDPGMQP*
Ga0137359_101870791	3300012923	Vadose Zone Soil	FNFGPAIDAGTYNLKLSVNGKDYTTKVVIETDPGMQF*
Ga0137416_108666992	3300012927	Vadose Zone Soil	GGFGGLFNIGLPLEPGVYVVKLSVNGKDYTTKVVIEADTPLNP*
Ga0137416_119143242	3300012927	Vadose Zone Soil	GGGFGGFFNLGPVIEPGTYAVKLSANGKDYTTKVIVEADPGMQP*
Ga0137410_103533792	3300012944	Vadose Zone Soil	GPVIEPGTYNLKLSVSGKDYTTKVVIETDPGMQP*
Ga0164301_108288152	3300012960	Soil	GGGGGFGGLFNQGLPLEAGTYQVKLSVGGKDYTTKVVVENDPGM*
Ga0164302_117259032	3300012961	Soil	GFGGFNFGTVLEPGTYAVKLSVNGKEYLTKAVIETDPGMIP*
Ga0134110_104345252	3300012975	Grasslands Soil	NLGPLLEPGTYNVKLSMNGKDYTTKAVIEVDPGMQP*
Ga0157373_103932482	3300013100	Corn Rhizosphere	GGGGFGGLFNLGLPLEAGTYNVKLTVNGKDYTTKVVVENDPGM*
Ga0157378_120164491	3300013297	Miscanthus Rhizosphere	NVFTQGLPLEAGTYNLTLSVGGKEYKTKIVVENDPGM*
Ga0163162_103425021	3300013306	Switchgrass Rhizosphere	NLGLPLEAGTYQVKLTVNGKDYTTRVVIENDPGM*
Ga0163162_103456963	3300013306	Switchgrass Rhizosphere	GFNLGLPLEVGTYQVKLTVGGKDYTTRVVIENDPGM*
Ga0163162_103461721	3300013306	Switchgrass Rhizosphere	FNQGLPLEAGTYNLKLSVGGKDYTTKIVVENDPGL*
Ga0163162_106760762	3300013306	Switchgrass Rhizosphere	FGGFAQGLPLEAGTYVVKLSVGGKDYTQKVVIENDPGVN*
Ga0157372_100158558	3300013307	Corn Rhizosphere	GGFNLGPQIEAGTYQVKLSVGGKDYSTRVVVENDPGM*
Ga0163163_101201653	3300014325	Switchgrass Rhizosphere	GGLFNQGLPLEAGTYNLKLTVGGKDYKTKIVVENDPGLQ*
Ga0157377_103798711	3300014745	Miscanthus Rhizosphere	GGGGFGGFFNQGLPLEAGTYQVKLSVGGQEYTTKVVVENDPGM*
Ga0167633_1096401	3300015069	Glacier Forefield Soil	GGGFGGFFNIGPAIDAGTYYLKLSVNGKEYTTKVVIENDPGIQF*
Ga0173483_108727771	3300015077	Soil	GGFGNVFNQGLPLEAGTYNVKLSIGGKDYTTKVVIENDPGL*
Ga0167660_10256661	3300015078	Glacier Forefield Soil	FNLGPAIDVGTYNLKLSVNGKDYTTKVVIEPDPGIQF*
Ga0182007_100519442	3300015262	Rhizosphere	GFGVFLAQGLPLEAGTYNVTLTVAGKEHKTKVVVENDPGL*
Ga0132256_1023814681	3300015372	Arabidopsis Rhizosphere	GPLLEPGTYNVKLSVNGKDYITKVVVEADPGIQQ*
Ga0132256_1031355822	3300015372	Arabidopsis Rhizosphere	FGGFFNQGLPLEAGTYQVKLSVGGKDYTTKVVVENDPGM*
Ga0132257_1005900892	3300015373	Arabidopsis Rhizosphere	GGLFNQGPLLEPGTYNVKLSVNGKDYITKVVVEADPGMQQ*
Ga0132257_1013856601	3300015373	Arabidopsis Rhizosphere	GGFGGFFNQGLPLEAGTYQVKLSVGGKDYTTKVVVENDPGM*
Ga0132255_1048624762	3300015374	Arabidopsis Rhizosphere	AFNQGLPLEAGTYNVKLSVGGKDYTTKVVIENDPGL*
Ga0182035_110312022	3300016341	Soil	NLGAPLEAGTYQVKLSVNGKDYTTKAVIENDPGIQP
Ga0066669_101056103	3300018482	Grasslands Soil	GFGGFFNLGPVIEPGTYNVKLSVNGKDYATKVVVETDPGMQP
Ga0187892_103089522	3300019458	Bio-Ooze	GLGALFNQGPVLEPATYIVKLFVGGKEYTTKVVVEADSWMGQ
Ga0193724_10502952	3300020062	Soil	SFGGQFGGPALEAGTYYLKLSVNGKDYTTKVVVENDPGMQP
Ga0247673_10011164	3300024224	Soil	LGPALEAGTYQVKLSVNGKDYTTKAVIENDPGIMP
Ga0207653_100470643	3300025885	Corn, Switchgrass And Miscanthus Rhizosphere	GFGNIFNIGLPLGGGTYNLKLTVGGKDYTTKIVVENDPGF
Ga0207647_105281372	3300025904	Corn Rhizosphere	LNQGVPLEAGTYNLKLSVGGKEYTTKIVVENDPGM
Ga0207643_102560881	3300025908	Miscanthus Rhizosphere	GFGGFNLGLPLEAGTYQVKLTVNGKDYTTRVVIENDPGM
Ga0207681_110566902	3300025923	Switchgrass Rhizosphere	GNLFNQGLPLEAGTYNLKLSVGGKDYTTKIVIENDPGL
Ga0207694_101101863	3300025924	Corn Rhizosphere	GFGGFLNQGLPLEAGTYNLKLTVGGKDYTTKIVIENDPGMN
Ga0207650_110058091	3300025925	Switchgrass Rhizosphere	FGGFNLGLPLEAGTYVVKLSVGGKDYTTKAVIENDPGVN
Ga0207650_117378752	3300025925	Switchgrass Rhizosphere	GGFGGIFNQGLPLEAGTYVVKVSVAGTDLTTKVVVENDPGLN
Ga0207701_100497541	3300025930	Corn, Switchgrass And Miscanthus Rhizosphere	FNLGLPLEAGTYQVKLTVNGKDYTTRVVIENDPGM
Ga0207690_115852981	3300025932	Corn Rhizosphere	FTQGLPLEAGTYNLKLTVGGKDYTTKIVVENDPGF
Ga0207709_112582181	3300025935	Miscanthus Rhizosphere	FNQGLPLEAGTYNLKLSVGGKDYTTKIVIENDPGL
Ga0207670_118072002	3300025936	Switchgrass Rhizosphere	GGFLNQGLPLEAGTYNLKLTVGGKDYTTKIVVENDPGM
Ga0207691_102823911	3300025940	Miscanthus Rhizosphere	GGGFGGFNLGLPLEAGTYQVKLTVNGKDYTTRVVIENDPGM
Ga0207711_100461091	3300025941	Switchgrass Rhizosphere	FNLGTPLEAGTYQVKLTVNGKDYTTKAVIENDPGIQP
Ga0207711_101435521	3300025941	Switchgrass Rhizosphere	GGFGGFNLGLPLEAGTYQVKLTVNGKDYTTRVVIENDPGM
Ga0207648_101381831	3300026089	Miscanthus Rhizosphere	FGGLFNQGLPLEAGTYNLKLSVGGKDYTTKIVVENDPGL
Ga0207648_104321042	3300026089	Miscanthus Rhizosphere	GGFGAALEAGTYQVKLTVNGKDYTTKAVIENDPGIQP
Ga0207648_106373741	3300026089	Miscanthus Rhizosphere	GGFGNLFNQGLPLEAGTYNLKLSVGGKDYTTKIVIENDPGL
Ga0207698_109755281	3300026142	Corn Rhizosphere	NLFNQGLPLEAGTYNLKLSVGGKDYTTKIVIENDPGL
Ga0209056_103941292	3300026538	Soil	FNVGPVIEPGTYAVKLSVNGKDYTTKVIVEADPGMLP
Ga0209215_10239352	3300027266	Forest Soil	GGFLNQGLPLEAGTYNLKLTVGGKDYTTKIVVENDPGL
Ga0209485_10321232	3300027691	Agricultural Soil	IFTQGLPLEAGTYNLKLTVNGKDYTTKVVIENDPGFN
Ga0209177_101763042	3300027775	Agricultural Soil	GGGGFGGAFNLGLPLEAGTYNVKLSVGGKDYTTKVVIENDPGL
Ga0209726_102455141	3300027815	Groundwater	GFFNAGPVIEPGTYAVKLSVNGKDYTNKVVVEADPGMLP
Ga0209814_103963402	3300027873	Populus Rhizosphere	QGPLLEPGTYNVKLSVNGKDYTTKVVVEADPGMQP
Ga0207428_101172753	3300027907	Populus Rhizosphere	GFGGFLNLGLPLEAGTYNLKLTVGGKDYTTKIVIENDPGM
Ga0268265_104518812	3300028380	Switchgrass Rhizosphere	GFGGFNLGTVLEPGTYAVKLSVNGKEYTTKAVIESDPGMIP
Ga0268264_106185211	3300028381	Switchgrass Rhizosphere	GFGGFNLGLPLEAGTYNLKLSVGGKEYATKIVVENDPGLQP
Ga0268264_113056992	3300028381	Switchgrass Rhizosphere	FNQGLPLEAGTYNLKLTVGGKDYTTKIVVENDPGQ
Ga0137415_112860621	3300028536	Vadose Zone Soil	GGFGGFGGFFNLGPVIEPGTYAVKLSANGKDYTTKVIVEADPGMQP
Ga0137415_114810311	3300028536	Vadose Zone Soil	GGFGGLFNIGLPLEPGVYVVKLSVNGKDYTTKVVIEADTPLNP
Ga0137415_114833512	3300028536	Vadose Zone Soil	FNLGPAVEVGTYNLKLSVNGKDYTTKVVIENDPGMQF
Ga0307504_103509461	3300028792	Soil	GGFFNIGPIIEPGTYNVKLSVNGKDYTTKVVVETDPGMQP
Ga0307406_116990552	3300031901	Rhizosphere	GGFGNIFIQGLPLESGTYVLKLTVSGKDYTTKVVVENDPGIN
Ga0307412_114718422	3300031911	Rhizosphere	FGNVFTQGLPLEAGAYNLKLTVGGKDYTTKIVVENDPGLN
Ga0307471_1040433862	3300032180	Hardwood Forest Soil	AFFNIGPVSEPGTYSVKLSLNGKDYTTKVVVEADPGMQP

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F035811

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences