Scaffold Ga0167641_100926

Overview

Basic Information

• Taxon OID: 3300015064
• Scaffold ID: Ga0167641_100926
• Source Dataset Name: Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G7B, Adjacent to main proglacial river, mid transect (Watson river))
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Bristol
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 5473
• Total Scaffold Genes: 9
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil → Metagenomes Of Arctic Soils

Source Dataset Sampling Location

• Location Name: Russell glacier, Kangerlussuaq, Greenland
• Coordinates
  • Lat. (^o): 67.08225
  • Long. (^o): -50.322435
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F000796	Metagenome / Metatranscriptome	887	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0167641_1009266	F000796	N/A	MLLGHELRSQLAHSPALWLTFGSLAVGHLWKAFQSGYDVMPEDQLKQRVRWDVCLLVLRAGAMFLMSAYRLYLILVPLMALLLTYMEVWPERVLGAVFGDPSRLWEYDPDEKTKR*