| Basic Information | |
|---|---|
| Taxon OID | 3300015061 Open in IMG/M |
| Scaffold ID | Ga0167635_100370 Open in IMG/M |
| Source Dataset Name | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G5B, Northern proglacial tributary margin, adjacent to top of river) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Bristol |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1886 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (80.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil → Metagenomes Of Arctic Soils |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Russell glacier, Kangerlussuaq, Greenland | |||||||
| Coordinates | Lat. (o) | 67.156461 | Long. (o) | -50.083665 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F007987 | Metagenome / Metatranscriptome | 341 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0167635_1003702 | F007987 | GGA | MIKQASTDHLDAAGSGSFSSATTIAALLFLAAKFPHRQFNSAELCVLSGVGRTAMSQIKNASDTPFSLGKCTPQRLDAWLAKHPGFKQD* |
| ⦗Top⦘ |