| Basic Information | |
|---|---|
| Taxon OID | 3300014966 Open in IMG/M |
| Scaffold ID | Ga0182824_10057105 Open in IMG/M |
| Source Dataset Name | Freshwater microbial mat microbial communities from Canadian High Arctic Lake, Ward Hunt Island, Canada - Sample WHa |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Laval University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 615 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Unclassified → Microbial Mat → Microbial Mat Communities From High Arctic Lakes |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Canada: Ward Hunt Island | |||||||
| Coordinates | Lat. (o) | 83.079722 | Long. (o) | -74.138056 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F068999 | Metagenome / Metatranscriptome | 124 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0182824_100571051 | F068999 | AGGAGG | MRGSGWLAAVVVAGWSQAALAAEMLPLKQGIYVPVNRPCKGASNAEMLNYRGEKSSFGSAQAACTIVKMTRRGNVFTITDKCVDIRGGGDIEGGPVVVTIASPTGFSKDGERYRYCGPRAQF* |
| ⦗Top⦘ |