Scaffold Ga0134538_1132154

Overview

Basic Information

• Taxon OID: 3300014964
• Scaffold ID: Ga0134538_1132154
• Source Dataset Name: Mouse gut microbial communities from Hong Kong to study the effect of probiotic LGG - Control W8
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Hong Kong
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 626
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Mammals → Digestive System → Unclassified → Unclassified → Mouse Gut → Mouse Gut Microbial Communities From Hong Kong To Study The Effect Of Probiotic Lgg

Source Dataset Sampling Location

• Location Name: Hong Kong
• Coordinates
  • Lat. (^o): 22.3356
  • Long. (^o): 114.1826

Associated Families

Family	Category	Number of Sequences	3D Structure?
F020828	Metagenome / Metatranscriptome	221	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0134538_11321541	F020828	N/A	ELAMKDLIVRMWPGEPLPDSYFGLIKRMVNACPQLEVIKQSICIEGARRALARAKVHWGKLDAEKLVKDGPPPGKEHRKPENYCKDVLKGACLVADECSRDVIFE*