Scaffold Ga0134538_1004061

Overview

Basic Information

• Taxon OID: 3300014964
• Scaffold ID: Ga0134538_1004061
• Source Dataset Name: Mouse gut microbial communities from Hong Kong to study the effect of probiotic LGG - Control W8
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Hong Kong
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 8026
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (12.50%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Mammals → Digestive System → Unclassified → Unclassified → Mouse Gut → Mouse Gut Microbial Communities From Hong Kong To Study The Effect Of Probiotic Lgg

Source Dataset Sampling Location

• Location Name: Hong Kong
• Coordinates
  • Lat. (^o): 22.3356
  • Long. (^o): 114.1826

Associated Families

Family	Category	Number of Sequences	3D Structure?
F050794	Metagenome	145	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0134538_10040618	F050794	N/A	RDQAFDYMTEFNKRLSDKVGIKCTMDILLPTDDDNANIIIEHNGIIKKLMKEAEKLELDTDAIKAMMCDLLDELKDDIDLNILIFDVSQLLIKYNLFRLEAITEQEFKNSFVRMDSRNMEIKKLTLSDIKKVVMMIETRYNRFVW*