Scaffold Ga0134538_1000070

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0134538_1000070

Scaffold Ga0134538_1000070

Overview

Basic Information
Taxon OID	3300014964 Open in IMG/M
Scaffold ID	Ga0134538_1000070 Open in IMG/M
Source Dataset Name	Mouse gut microbial communities from Hong Kong to study the effect of probiotic LGG - Control W8
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Hong Kong
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	125153
Total Scaffold Genes	148 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	45 (30.41%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Unclassified → Unclassified → Mouse Gut → Mouse Gut Microbial Communities From Hong Kong To Study The Effect Of Probiotic Lgg

Source Dataset Sampling Location
Location Name	Hong Kong
Coordinates	Lat. (^o)	22.3356	Long. (^o)	114.1826	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F099451	Metagenome	103	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0134538_100007088	F099451	N/A	MSEIKTVGDLRKVIANLDDSFKIEMRIRRKLTDEELKYMPYPYPYETEYSTLEFDDIGYSDKELCLGVERGQNNE*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.