Basic Information | |
---|---|
Taxon OID | 3300014963 Open in IMG/M |
Scaffold ID | Ga0134523_1007753 Open in IMG/M |
Source Dataset Name | Human fecal microbial communities from elderly subjects during probiotic consumption in Boston, USA - meta_42827d56 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Maryland School of Medicine |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 9431 |
Total Scaffold Genes | 16 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (31.25%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides xylanisolvens | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Elderly Subjects During Probiotic Consumption In Boston, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Boston | |||||||
Coordinates | Lat. (o) | 42.3601 | Long. (o) | -71.0589 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F051936 | Metagenome | 143 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0134523_100775312 | F051936 | N/A | MKQEGTGQVLFFPLALRGKAFGFSVLQEHAVMTPVTSIFFSRLIIRYLSIHISIKK* |
⦗Top⦘ |