Scaffold Ga0134526_1066853

Overview

Basic Information

• Taxon OID: 3300014961
• Scaffold ID: Ga0134526_1066853
• Source Dataset Name: Wastewater microbial communities from medical facility sewage samples near Freiburg, Germany - C1747
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Freiburg
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 586
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Eubacteriales incertae sedis → Gemmiger → Gemmiger formicilis (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Wastewater → Wastewater Microbial Communities From Medical Facility Sewage Samples Near Freiburg, Germany

Source Dataset Sampling Location

• Location Name: Germany: Freiburg
• Coordinates
  • Lat. (^o): 48.0
  • Long. (^o): 8.0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F090515	Metagenome	108	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0134526_10668532	F090515	N/A	PGRVACLEFAGGEKRKTNIAADYAVKVPAFTALLCRHIGSIRTFLKS*