Scaffold Ga0134526_1026336

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0134526_1026336

Scaffold Ga0134526_1026336

Overview

Basic Information
Taxon OID	3300014961 Open in IMG/M
Scaffold ID	Ga0134526_1026336 Open in IMG/M
Source Dataset Name	Wastewater microbial communities from medical facility sewage samples near Freiburg, Germany - C1747
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Freiburg
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1227
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Wastewater → Wastewater Microbial Communities From Medical Facility Sewage Samples Near Freiburg, Germany

Source Dataset Sampling Location
Location Name	Germany: Freiburg
Coordinates	Lat. (^o)	48.0	Long. (^o)	8.0	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F050794	Metagenome	145	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0134526_10263361	F050794	AGG	MLYTSNYFVKVRQKQLLDHTYSLSRDQAFDYMTEFNKRLSDKVGIKCTMDILLPTDDDNANIIIEYNGIIKKLMREAEKLELDTDAIEAMMRDLLDELKDDIDLNILIFDVSQLLIKYNLFRLDAITEQEFKDSFVRMDSRNMEIKKLTLSDIKKVVEMIEDRYSYALYMTEEYG*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.