| Basic Information | |
|---|---|
| Taxon OID | 3300014961 Open in IMG/M |
| Scaffold ID | Ga0134526_1014823 Open in IMG/M |
| Source Dataset Name | Wastewater microbial communities from medical facility sewage samples near Freiburg, Germany - C1747 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Freiburg |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1947 |
| Total Scaffold Genes | 6 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter calcoaceticus/baumannii complex → Acinetobacter baumannii | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Wastewater → Wastewater Microbial Communities From Medical Facility Sewage Samples Near Freiburg, Germany |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Germany: Freiburg | |||||||
| Coordinates | Lat. (o) | 48.0 | Long. (o) | 8.0 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F044555 | Metagenome / Metatranscriptome | 154 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0134526_10148235 | F044555 | N/A | MKTTNPSSRITISQNGNQILTCKVYKEPNYILSMSNEEILELISGLDYIGNLPTVPDLEKPIGIQVSTIRQIPLEQNKEVQTKIKEIIYNNLYDTLIDELKGTISRFQAQYNIQEINPYLQDILQNPEDLVSLSQHHKR* |
| ⦗Top⦘ |