| Basic Information | |
|---|---|
| Taxon OID | 3300014955 Open in IMG/M |
| Scaffold ID | Ga0134561_1001525 Open in IMG/M |
| Source Dataset Name | Human fecal microbial community of Hadza hunter-gatherer populations from Tanzania - 10025 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Bologna |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 8025 |
| Total Scaffold Genes | 8 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 6 (75.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Community Of Hadza Hunter-Gatherer And Regular Subjects From Tanzania And Italy |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Tanzania | |||||||
| Coordinates | Lat. (o) | -3.6347588 | Long. (o) | 35.0828588 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F047125 | Metagenome / Metatranscriptome | 150 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0134561_10015254 | F047125 | AGGA | MDVVLLLMVLGVMLSGFRAADALDHMRKEILQQEGKRCGWWS* |
| ⦗Top⦘ |