Scaffold Ga0169857_121838

Overview

Basic Information

• Taxon OID: 3300014946
• Scaffold ID: Ga0169857_121838
• Source Dataset Name: Human fecal microbial communities from infant at 12 months in Denmark - 635_12M
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Beijing Genomics Institute (BGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 651
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Subdoligranulum → unclassified Subdoligranulum → Subdoligranulum sp. APC924/74 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Host-Associated → Human Host-Associated Microbial Communities From Fecal Samples Of Mother And Infant In Denmark

Source Dataset Sampling Location

• Location Name: Denmark
• Coordinates
  • Lat. (^o): 55.678
  • Long. (^o): 12.531

Associated Families

Family	Category	Number of Sequences	3D Structure?
F047126	Metagenome	150	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0169857_1218383	F047126	N/A	GILCGFQGFLTQNPAALVETDDIFDVSDTPYGFSGLNTLRAAGVPNPPPPFAQRFIACFCSQTAAASQSKSAYILSSLESPCILCSLLRYFHILSKKLQKTC*