Scaffold Ga0134572_100399

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0134572_100399

Scaffold Ga0134572_100399

Overview

Basic Information
Taxon OID	3300014931 Open in IMG/M
Scaffold ID	Ga0134572_100399 Open in IMG/M
Source Dataset Name	Human fecal microbial community from subjects in taly - 20011
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Bologna
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	5351
Total Scaffold Genes	10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (20.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Community Of Hadza Hunter-Gatherer And Regular Subjects From Tanzania And Italy

Source Dataset Sampling Location
Location Name	Italy
Coordinates	Lat. (^o)	44.4950537	Long. (^o)	11.3427401	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F044555	Metagenome / Metatranscriptome	154	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0134572_1003996	F044555	N/A	MKTITRITINQNGNQILTCKVCKDINNILFMSNEGILELISGLNYMDNLPIVPDLEKPIEIQITVIREIPIEQNKKVQTKIKEIIYNNLYDTLIDELKGTISRFQAQYNIQEINPYISDILQNPEDLISRSNTKEYR*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.