Scaffold Ga0134572_100228

Overview

Basic Information

• Taxon OID: 3300014931
• Scaffold ID: Ga0134572_100228
• Source Dataset Name: Human fecal microbial community from subjects in taly - 20011
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Bologna
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 10022
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (42.86%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Podoviridae sp. ct1h53 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Community Of Hadza Hunter-Gatherer And Regular Subjects From Tanzania And Italy

Source Dataset Sampling Location

• Location Name: Italy
• Coordinates
  • Lat. (^o): 44.4950537
  • Long. (^o): 11.3427401

Associated Families

Family	Category	Number of Sequences	3D Structure?
F098313	Metagenome	104	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0134572_1002282	F098313	N/A	MKEKEFDFVIYPLKLIITIGLDYKTLCDRFENAEPDHEGEWGSESDLDSESSFMNLVRDKGDDRAFKLLWNFQSENDMTIQNICHESFHAAMSVCQHCNMSLGFKVGEDEHAAYIAGFVGNCAGEMFGFLEEEKDGKEE*