NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0134572_100228

Scaffold Ga0134572_100228


Overview

Basic Information
Taxon OID3300014931 Open in IMG/M
Scaffold IDGa0134572_100228 Open in IMG/M
Source Dataset NameHuman fecal microbial community from subjects in taly - 20011
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Bologna
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)10022
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (42.86%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Podoviridae sp. ct1h53(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Community Of Hadza Hunter-Gatherer And Regular Subjects From Tanzania And Italy

Source Dataset Sampling Location
Location NameItaly
CoordinatesLat. (o)44.4950537Long. (o)11.3427401Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F098313Metagenome104N

Sequences

Protein IDFamilyRBSSequence
Ga0134572_1002282F098313N/AMKEKEFDFVIYPLKLIITIGLDYKTLCDRFENAEPDHEGEWGSESDLDSESSFMNLVRDKGDDRAFKLLWNFQSENDMTIQNICHESFHAAMSVCQHCNMSLGFKVGEDEHAAYIAGFVGNCAGEMFGFLEEEKDGKEE*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.