Scaffold Ga0119870_1116032

Overview

Basic Information

• Taxon OID: 3300014833
• Scaffold ID: Ga0119870_1116032
• Source Dataset Name: Activated sludge microbial communities from Shanghai, China - wastewater treatment plant - influent sewage
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Tongji University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 804
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Streptococcaceae → Streptococcus → Streptococcus pneumoniae (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge → Activated Sludge Microbial Communities From Shanghai, China

Source Dataset Sampling Location

• Location Name: China: Quyang, Shanghai
• Coordinates
  • Lat. (^o): 31.3
  • Long. (^o): 121.5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F075867	Metagenome / Metatranscriptome	118	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0119870_11160323	F075867	N/A	HFLQYDAATFENEGFKTLNGRISQLALEPRFWSVSVKVITENFEGTEKIKDHFNFKTSERCKLSDLREQVKKEVLDKDDYLPVCTQCLVTARVMM*