NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0119870_1066280

Scaffold Ga0119870_1066280


Overview

Basic Information
Taxon OID3300014833 Open in IMG/M
Scaffold IDGa0119870_1066280 Open in IMG/M
Source Dataset NameActivated sludge microbial communities from Shanghai, China - wastewater treatment plant - influent sewage
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterTongji University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1146
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge → Activated Sludge Microbial Communities From Shanghai, China

Source Dataset Sampling Location
Location NameChina: Quyang, Shanghai
CoordinatesLat. (o)31.3Long. (o)121.5Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F055725Metagenome / Metatranscriptome138Y

Sequences

Protein IDFamilyRBSSequence
Ga0119870_10662802F055725AGAAGGMAFFNGEGIDLPTITKLAEAGVSLNGMATITGHSRTGIKRALERNKIPFATHVRERFVVVDGVLTSLGDACNAQGFSRKAMYAWRVKRGLNEQEGFDAYIVYQQSKRTIDKPILTFKNATVIYKKERYTLTEISDKLKLNKQRFEVFMRQNRYAQNAFERYCYMRGL*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.