Scaffold Ga0119870_1057998

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0119870_1057998

Scaffold Ga0119870_1057998

Overview

Basic Information
Taxon OID	3300014833 Open in IMG/M
Scaffold ID	Ga0119870_1057998 Open in IMG/M
Source Dataset Name	Activated sludge microbial communities from Shanghai, China - wastewater treatment plant - influent sewage
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Tongji University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1248
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge → Activated Sludge Microbial Communities From Shanghai, China

Source Dataset Sampling Location
Location Name	China: Quyang, Shanghai
Coordinates	Lat. (^o)	31.3	Long. (^o)	121.5	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F076005	Metagenome / Metatranscriptome	118	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0119870_10579982	F076005	N/A	MTGEIMKHFKIKVQYLNGNEFCFECDAKTNWQAAALARIKGKELGLGGAMDVKETIVEEA

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.