Scaffold Ga0167340_1168181

Overview

Basic Information

• Taxon OID: 3300014831
• Scaffold ID: Ga0167340_1168181
• Source Dataset Name: Raw sludge microbial communities from sewage treatment plant in Sweden - SWESTP63 - Kappala-primary 226
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Gothenburg
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 602
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Raw Primary Sludge → Sewage Microbial Communities From Wastewater Treatment Plant In Sweden

Source Dataset Sampling Location

• Location Name: Sweden
• Coordinates
  • Lat. (^o): 59.355554
  • Long. (^o): 18.227079

Associated Families

Family	Category	Number of Sequences	3D Structure?
F067845	Metagenome	125	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0167340_11681811	F067845	N/A	LLAGVLALGVLTACSGLGGVNTGTDAEKAAELAQQLGVAHTQELDNTAKAVAEWFVQEPDSLRVSGLDLVYTVALDADSNMGYTGDLNKFLYWSGCYGVPEDVTVALLLDDSTAMTAQLYAPQADSAAVELLDDAADHSELGAAFIDYNGTAYVVAVFR*