Scaffold Ga0167340_1145027

Overview

Basic Information

• Taxon OID: 3300014831
• Scaffold ID: Ga0167340_1145027
• Source Dataset Name: Raw sludge microbial communities from sewage treatment plant in Sweden - SWESTP63 - Kappala-primary 226
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Gothenburg
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 661
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → unclassified Parcubacteria group → Parcubacteria group bacterium ADurb.Bin216 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Raw Primary Sludge → Sewage Microbial Communities From Wastewater Treatment Plant In Sweden

Source Dataset Sampling Location

• Location Name: Sweden
• Coordinates
  • Lat. (^o): 59.355554
  • Long. (^o): 18.227079

Associated Families

Family	Category	Number of Sequences	3D Structure?
F030759	Metagenome / Metatranscriptome	184	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0167340_11450272	F030759	AGG	VKFLSWFGTFASIIGSFVVASQIFLLGYCFFIAGSVSWLLVGWLRRDASLMVLNGTFMLANFWGLYVAI*