Scaffold Ga0119906_1209976

Overview

Basic Information

• Taxon OID: 3300014830
• Scaffold ID: Ga0119906_1209976
• Source Dataset Name: Activated sludge bacterial and viral communities from EBPR bioreactors in Brisbane, Australia - M92511
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: California Institute of Technology
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 549
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor → Activated Sludge → Activated Sludge Bacterial And Viral Communities From Ebpr Bioreactors In Australia

Source Dataset Sampling Location

• Location Name: Australia: Thorneside Wastwater Treatment Plant
• Coordinates
  • Lat. (^o): -27.485973
  • Long. (^o): 153.190699

Associated Families

Family	Category	Number of Sequences	3D Structure?
F104545	Metagenome / Metatranscriptome	100	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0119906_12099761	F104545	N/A	AKHAQKRIDRQQAGNDCDAATRAVRAPTASGQPEVEPVGTILGSVGRHKTCRDVPAERDRTRRGLELAPMPRPFQHAGVKAAAQTSDRG*