| Basic Information | |
|---|---|
| Taxon OID | 3300014824 Open in IMG/M |
| Scaffold ID | Ga0134492_1011237 Open in IMG/M |
| Source Dataset Name | Human fecal microbial communities from ulcerative colitis therapy, University of Washington - UWIBD01P279T2 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Washington |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 4848 |
| Total Scaffold Genes | 8 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 6 (75.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Commmunities From Fecal Microbiota Transplantation (Fmt) For Ulcerative Colitis - University Of Washington |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: University of Washington | |||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F076189 | Metagenome | 118 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0134492_10112373 | F076189 | N/A | MPGRLCYLPGIAFFLSPFIKPLLYVEKLQIGTVLPVVSDLYREFAELSAHFDLRAIQSAQKQLRMLYNFHENTFGLLIFYANYAIL* |
| ⦗Top⦘ |