Scaffold Ga0134492_1001466

Overview

Basic Information

• Taxon OID: 3300014824
• Scaffold ID: Ga0134492_1001466
• Source Dataset Name: Human fecal microbial communities from ulcerative colitis therapy, University of Washington - UWIBD01P279T2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Washington
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 27315
• Total Scaffold Genes: 24
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 13 (54.17%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Commmunities From Fecal Microbiota Transplantation (Fmt) For Ulcerative Colitis - University Of Washington

Source Dataset Sampling Location

• Location Name: USA: University of Washington
• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F071325	Metagenome	122	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0134492_100146624	F071325	N/A	DFPSRLRFHKFQYCSIFKVLLALLLDSSIIISKVVLFVKHFFDIFLSFPNAFLKAFHPHAVRFPAAFLLVHRFYLAFEELLSCATAYL*