| Basic Information | |
|---|---|
| Taxon OID | 3300014790 Open in IMG/M |
| Scaffold ID | Ga0134419_1001920 Open in IMG/M |
| Source Dataset Name | Human fecal microbial communities from obese patients in Germany - AS50_24 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Hohenheim |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 7003 |
| Total Scaffold Genes | 11 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 7 (63.64%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Obese Patients In Germany |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Germany | |||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F032286 | Metagenome / Metatranscriptome | 180 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0134419_10019204 | F032286 | N/A | MVKWVCQIVTPVRHRALVFNTRLFAGNAADDTLVTGDTFHFCRLVCLCVKRRNIILNGKRRSLLNSTLFRADNRTEQKTISPFSLALIFTFDFAALSERRSCPEDRSRRFVPVGTLALSRSWRLLRWGTYPVRTVMQFSRFRCDCKTILAKNIDLSRISKRSENAPKNADFHAYGQDRKRTEN* |
| ⦗Top⦘ |