Scaffold Ga0134390_125155

Overview

Basic Information

• Taxon OID: 3300014783
• Scaffold ID: Ga0134390_125155
• Source Dataset Name: Human fecal microbial communities from obese patients in Germany - AS43_12
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Hohenheim
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 701
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Obese Patients In Germany

Source Dataset Sampling Location

• Location Name: Germany
• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F067845	Metagenome	125	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0134390_1251551	F067845	AGGAG	MKHWKNLLVCLLAGVLALGVLTACSGLGSVNTGTDAEKAAELAQQLGVAHTQELDNTAKAVAEWFVQEPDSLRVSGLDLVYTVALDADNNMSHTDDLNDFLYWSGCYGVPDDVTVALLLDDSAAMTAQLYAPQADSAAAKLLEDAAGHSELGAAFIDYNGTAYVVAVFR*