NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0134477_1009779

Scaffold Ga0134477_1009779


Overview

Basic Information
Taxon OID3300014780 Open in IMG/M
Scaffold IDGa0134477_1009779 Open in IMG/M
Source Dataset NameHuman fecal microbial communities from ulcerative colitis therapy, University of Washington - UWIBD01D049B1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Washington
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1876
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (40.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Commmunities From Fecal Microbiota Transplantation (Fmt) For Ulcerative Colitis - University Of Washington

Source Dataset Sampling Location
Location NameUSA: University of Washington
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F080673Metagenome115N

Sequences

Protein IDFamilyRBSSequence
Ga0134477_10097793F080673N/AMNMNEIELLRLQDEALSYLRDNITKDEAYYVLTTDKDMIEILIADKKDGSKRIKILDMEYTIEKDDMLLLFDTDGIIDECLLAASYIGVNMYFRRQDVNAILNNINREKVMKYPYIAIQLDNIQTIEKRRVIFEITGHRIDDNKEKIDFMFVYFMARIL*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.