Scaffold Ga0134477_1008230

Overview

Basic Information

• Taxon OID: 3300014780
• Scaffold ID: Ga0134477_1008230
• Source Dataset Name: Human fecal microbial communities from ulcerative colitis therapy, University of Washington - UWIBD01D049B1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Washington
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2192
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Commmunities From Fecal Microbiota Transplantation (Fmt) For Ulcerative Colitis - University Of Washington

Source Dataset Sampling Location

• Location Name: USA: University of Washington
• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F057001	Metagenome	137	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0134477_10082301	F057001	N/A	HQMPIQAPRVRANLMTNKELNKVQNEVKKASEKTLTGAVKAWCQLFKSGKEINEILKENEIKVDKSIVSALVNLAKDKEVVIQLCKEILPRVNNTFCAYREVKREYYDKNEQDKNKNLKMSEIEDIAILGSYHKRFGYNEPVEYDFGIYYETFNGADKRIIKCAVPIKRYTFSLIAKCVTYYLTHPKNER*