NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0120686_1007777

Scaffold Ga0120686_1007777


Overview

Basic Information
Taxon OID3300014763 Open in IMG/M
Scaffold IDGa0120686_1007777 Open in IMG/M
Source Dataset NameAquatic prokaryotic and eukaryotic communities from a canal in New York, USA: aquatic canal water -GCSS-11
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterWeill Cornell Medical College
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)550
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Built Environment → Canal → Unclassified → Unclassified → Aquatic Canal → Urban Prokaryotic And Eukaryotic Communities From The Subway And Surrounding Areas In New York, Usa

Source Dataset Sampling Location
Location NameUSA:New York City
CoordinatesLat. (o)40.67Long. (o)-73.99Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009753Metagenome / Metatranscriptome313Y

Sequences

Protein IDFamilyRBSSequence
Ga0120686_10077771F009753GAGGMLYAIYFALHFAMVFLGVVIAIHFDMTIGLLIATTFGVKFLFMLPNNR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.