| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300014763 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0118444 | Gp0134406 | Ga0120686 |
| Sample Name | Aquatic prokaryotic and eukaryotic communities from a canal in New York, USA: aquatic canal water -GCSS-11 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Weill Cornell Medical College |
| Published? | Y |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 50858465 |
| Sequencing Scaffolds | 4 |
| Novel Protein Genes | 4 |
| Associated Families | 4 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 1 |
| Not Available | 2 |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Urban Prokaryotic And Eukaryotic Communities From The Subway And Surrounding Areas In New York, Usa |
| Type | Engineered |
| Taxonomy | Engineered → Built Environment → Canal → Unclassified → Unclassified → Aquatic Canal → Urban Prokaryotic And Eukaryotic Communities From The Subway And Surrounding Areas In New York, Usa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA:New York City | |||||||
| Coordinates | Lat. (o) | 40.67 | Long. (o) | -73.99 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F009460 | Metagenome / Metatranscriptome | 317 | N |
| F009753 | Metagenome / Metatranscriptome | 313 | Y |
| F052541 | Metagenome / Metatranscriptome | 142 | Y |
| F065254 | Metagenome | 128 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0120686_1001890 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 755 | Open in IMG/M |
| Ga0120686_1002385 | Not Available | 718 | Open in IMG/M |
| Ga0120686_1006021 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium | 583 | Open in IMG/M |
| Ga0120686_1007777 | Not Available | 550 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0120686_1001890 | Ga0120686_10018902 | F065254 | CSEQAEKTSVARESLLWGCPITNFKATLPFNRMKQAFAAFKKRPRGPARLRP* |
| Ga0120686_1002385 | Ga0120686_10023852 | F052541 | MVKLILSNEKKITLKRGDKTITRSLLDYETNKAMYDFRGFKQVQDTVKEIKEVKVQDEKVVPL |
| Ga0120686_1006021 | Ga0120686_10060211 | F009460 | MAKWDLSKLENSASVGAHIDEDSSTPTQPTPLMLVMSIRRKADIMRMDAGRGPERLTIKQRAEEIMALCE |
| Ga0120686_1007777 | Ga0120686_10077771 | F009753 | MLYAIYFALHFAMVFLGVVIAIHFDMTIGLLIATTFGVKFLFMLPNNR |
| ⦗Top⦘ |