Scaffold Ga0135282_10943

Overview

Basic Information

• Taxon OID: 3300014716
• Scaffold ID: Ga0135282_10943
• Source Dataset Name: Maize phyllosphere microbial communities from California to study drought stress - PHYLLO11_watered_CA_Berkeley
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: J. Craig Venter Institute
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 544
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Maize Phyllosphere → Maize Phyllosphere Microbial Communities From Texas And California To Study Drought Stress

Source Dataset Sampling Location

• Location Name: USA: Berkeley, California
• Coordinates
  • Lat. (^o): 37.53128
  • Long. (^o): -122.7598

Associated Families

Family	Category	Number of Sequences	3D Structure?
F096761	Metagenome / Metatranscriptome	104	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0135282_109431	F096761	N/A	LRLQGASVPEGALSLTHWNPVLLQQRVSDLEMANAG*