NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F096761

Metagenome / Metatranscriptome Family F096761

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F096761
Family Type Metagenome / Metatranscriptome
Number of Sequences 104
Average Sequence Length 48 residues
Representative Sequence MFIRSSYQALVDGMASQLKSQGASIPEVASSLERWNPVLLHRRVSELEATNAG
Number of Associated Samples 45
Number of Associated Scaffolds 104

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 17.31 %
% of genes near scaffold ends (potentially truncated) 57.69 %
% of genes from short scaffolds (< 2000 bps) 99.04 %
Associated GOLD sequencing projects 32
AlphaFold2 3D model prediction Yes
3D model pTM-score0.46

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (77.885 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere
(36.538 % of family members)
Environment Ontology (ENVO) Unclassified
(58.654 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(62.500 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 51.85%    β-sheet: 0.00%    Coil/Unstructured: 48.15%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.46
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.08 %
UnclassifiedrootN/A1.92 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005327|Ga0070658_10696888All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays881Open in IMG/M
3300005327|Ga0070658_10801182All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays818Open in IMG/M
3300005327|Ga0070658_11312609All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays628Open in IMG/M
3300005327|Ga0070658_11709884All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella → unclassified Salmonella → Salmonella sp. hn-f5544Open in IMG/M
3300005327|Ga0070658_11825785All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays525Open in IMG/M
3300005336|Ga0070680_101020720All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays714Open in IMG/M
3300005336|Ga0070680_101594378All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella → unclassified Salmonella → Salmonella sp. hn-f5566Open in IMG/M
3300005336|Ga0070680_101763139All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae537Open in IMG/M
3300005336|Ga0070680_102005011All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays501Open in IMG/M
3300005337|Ga0070682_100918665All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays720Open in IMG/M
3300005339|Ga0070660_100802762All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays791Open in IMG/M
3300005339|Ga0070660_101513601All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella → unclassified Salmonella → Salmonella sp. hn-f5571Open in IMG/M
3300005344|Ga0070661_100406301All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays1077Open in IMG/M
3300005344|Ga0070661_100802362All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays772Open in IMG/M
3300005455|Ga0070663_100414699All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays1103Open in IMG/M
3300005455|Ga0070663_101529963All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella → unclassified Salmonella → Salmonella sp. hn-f5593Open in IMG/M
3300005455|Ga0070663_101908407All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella → unclassified Salmonella → Salmonella sp. hn-f5533Open in IMG/M
3300005457|Ga0070662_100984593All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae721Open in IMG/M
3300005457|Ga0070662_101228045All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays644Open in IMG/M
3300005457|Ga0070662_101309348All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays623Open in IMG/M
3300005457|Ga0070662_101808649All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella → unclassified Salmonella → Salmonella sp. hn-f5528Open in IMG/M
3300005457|Ga0070662_102001387All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella → unclassified Salmonella → Salmonella sp. hn-f5501Open in IMG/M
3300005458|Ga0070681_10381339All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays1320Open in IMG/M
3300005458|Ga0070681_10398596All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays1287Open in IMG/M
3300005530|Ga0070679_100607846All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays1036Open in IMG/M
3300005530|Ga0070679_101186300All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays708Open in IMG/M
3300005577|Ga0068857_101752750All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays607Open in IMG/M
3300005577|Ga0068857_101757807All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays607Open in IMG/M
3300005577|Ga0068857_101786810All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella → unclassified Salmonella → Salmonella sp. hn-f5602Open in IMG/M
3300005614|Ga0068856_102328326Not Available543Open in IMG/M
3300005834|Ga0068851_10633847All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella → unclassified Salmonella → Salmonella sp. hn-f5653Open in IMG/M
3300006876|Ga0079217_10337164All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays856Open in IMG/M
3300006876|Ga0079217_10346494All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays849Open in IMG/M
3300006879|Ga0079226_10530816All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays734Open in IMG/M
3300007004|Ga0079218_10263798All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays1370Open in IMG/M
3300007004|Ga0079218_12058985All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella → unclassified Salmonella → Salmonella sp. hn-f5655Open in IMG/M
3300009545|Ga0105237_12067396All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella → unclassified Salmonella → Salmonella sp. hn-f5578Open in IMG/M
3300009545|Ga0105237_12743367All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays504Open in IMG/M
3300012905|Ga0157296_10168849All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays671Open in IMG/M
3300012905|Ga0157296_10380685All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays522Open in IMG/M
3300013102|Ga0157371_10308134All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays1147Open in IMG/M
3300013104|Ga0157370_11950057All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays527Open in IMG/M
3300013307|Ga0157372_11358546All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays819Open in IMG/M
3300014716|Ga0135282_10943All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays544Open in IMG/M
3300020077|Ga0206351_10145588Not Available694Open in IMG/M
3300020815|Ga0214108_10511738All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays643Open in IMG/M
3300020815|Ga0214108_10786519All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays580Open in IMG/M
3300020815|Ga0214108_10808478All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays810Open in IMG/M
3300020816|Ga0214090_11039748All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays716Open in IMG/M
3300021966|Ga0226662_10077909All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays1236Open in IMG/M
3300021966|Ga0226662_10267368All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella → unclassified Salmonella → Salmonella sp. hn-f5630Open in IMG/M
3300021966|Ga0226662_10291835All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella → unclassified Salmonella → Salmonella sp. hn-f5605Open in IMG/M
3300023205|Ga0255814_10061708All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays658Open in IMG/M
3300023205|Ga0255814_10747005All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays639Open in IMG/M
3300023205|Ga0255814_10858818All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays505Open in IMG/M
3300023205|Ga0255814_11234878All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays730Open in IMG/M
3300023300|Ga0256702_10729500All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays924Open in IMG/M
3300023300|Ga0256702_11067304All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays579Open in IMG/M
3300023300|Ga0256702_11536836All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella → unclassified Salmonella → Salmonella sp. hn-f5524Open in IMG/M
3300023300|Ga0256702_12368505All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays852Open in IMG/M
3300025909|Ga0207705_10776910All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays744Open in IMG/M
3300025909|Ga0207705_11235855All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays572Open in IMG/M
3300025909|Ga0207705_11471597All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays516Open in IMG/M
3300025912|Ga0207707_10819380All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays774Open in IMG/M
3300025912|Ga0207707_11206163All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays612Open in IMG/M
3300025912|Ga0207707_11634196All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella → unclassified Salmonella → Salmonella sp. hn-f5506Open in IMG/M
3300025917|Ga0207660_11354776All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella → unclassified Salmonella → Salmonella sp. hn-f5577Open in IMG/M
3300025917|Ga0207660_11666578All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays513Open in IMG/M
3300025919|Ga0207657_10426689All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays1042Open in IMG/M
3300025919|Ga0207657_10636831All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays830Open in IMG/M
3300025919|Ga0207657_11202803All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays576Open in IMG/M
3300025919|Ga0207657_11470565All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays510Open in IMG/M
3300025920|Ga0207649_10853001All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays713Open in IMG/M
3300025920|Ga0207649_10939595All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays679Open in IMG/M
3300025920|Ga0207649_11174885All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae606Open in IMG/M
3300025920|Ga0207649_11437102All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella → unclassified Salmonella → Salmonella sp. hn-f5546Open in IMG/M
3300025920|Ga0207649_11573993All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays520Open in IMG/M
3300025920|Ga0207649_11663964All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays505Open in IMG/M
3300025921|Ga0207652_10391545All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays1254Open in IMG/M
3300025933|Ga0207706_10114323All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays2374Open in IMG/M
3300025933|Ga0207706_10564380All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays979Open in IMG/M
3300025933|Ga0207706_11027485All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays691Open in IMG/M
3300025933|Ga0207706_11671660All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae513Open in IMG/M
3300025945|Ga0207679_10893907All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays812Open in IMG/M
3300026067|Ga0207678_10783898All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays841Open in IMG/M
3300026067|Ga0207678_10842510All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays810Open in IMG/M
3300026067|Ga0207678_11425020All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays612Open in IMG/M
3300026116|Ga0207674_10549128All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays1116Open in IMG/M
3300027886|Ga0209486_10669996All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays666Open in IMG/M
3300029799|Ga0311022_10416911All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays560Open in IMG/M
3300029799|Ga0311022_12139981All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays504Open in IMG/M
3300029799|Ga0311022_12944808All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella → unclassified Salmonella → Salmonella sp. hn-f5550Open in IMG/M
3300029799|Ga0311022_14862858All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays738Open in IMG/M
3300031548|Ga0307408_101139342All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays725Open in IMG/M
3300031548|Ga0307408_102332726All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays519Open in IMG/M
3300031824|Ga0307413_11772770All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays552Open in IMG/M
3300031901|Ga0307406_11235661All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella → unclassified Salmonella → Salmonella sp. hn-f5650Open in IMG/M
3300031901|Ga0307406_11286997All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays638Open in IMG/M
3300031995|Ga0307409_101182530All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays788Open in IMG/M
3300032002|Ga0307416_102025594All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays678Open in IMG/M
3300032002|Ga0307416_102128632All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella → unclassified Salmonella → Salmonella sp. hn-f5663Open in IMG/M
3300032002|Ga0307416_102142225All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella → unclassified Salmonella → Salmonella sp. hn-f5661Open in IMG/M
3300032002|Ga0307416_102731599All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae590Open in IMG/M
3300032005|Ga0307411_11505293All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays619Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere36.54%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere14.42%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere10.58%
Food WasteEngineered → Solid Waste → Landfill → Unclassified → Unclassified → Food Waste9.62%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere5.77%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil4.81%
Food WasteEngineered → Bioreactor → Aerobic → Unclassified → Unclassified → Food Waste4.81%
Anaerobic Digester DigestateEngineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Digester Digestate3.85%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.92%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.92%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Agricultural Soil0.96%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.96%
Maize PhyllosphereHost-Associated → Plants → Phylloplane → Unclassified → Unclassified → Maize Phyllosphere0.96%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005327Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaGHost-AssociatedOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005834Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2Host-AssociatedOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300006879Agricultural soil microbial communities from Georgia to study Nitrogen management - Poultry litter 2014EnvironmentalOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300012905Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2EnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014716Maize phyllosphere microbial communities from California to study drought stress - PHYLLO11_watered_CA_BerkeleyHost-AssociatedOpen in IMG/M
3300020077Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020815Food waste microbial community from Durham, Ontario, Canada - FW2 megahitEngineeredOpen in IMG/M
3300020816Food waste microbial community from Durham, Ontario, Canada - FW1 megahitEngineeredOpen in IMG/M
3300021966Food waste microbial community from Durham, Ontario, Canada - FW2 spadesEngineeredOpen in IMG/M
3300023205Combined Assembly of Gp0242100, Gp0242119EngineeredOpen in IMG/M
3300023300Food waste microbial community from Durham, Ontario, Canada. Combined Assembly of Gp0238881, Gp0242100EngineeredOpen in IMG/M
3300025909Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027886Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)EnvironmentalOpen in IMG/M
3300029799Metagenomes from anaerobic digester of solid waste, Toronto, Canda. Combined Assembly of Gp0238878, Gp0238879, Gp0242100, Gp0242119EngineeredOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031824Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2Host-AssociatedOpen in IMG/M
3300031901Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2Host-AssociatedOpen in IMG/M
3300031995Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2Host-AssociatedOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032005Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0070658_1069688823300005327Corn RhizosphereMIIRSSYQALVDGMVGQLKSQGASIPEVASSLERWNPVLLRSRVSELEAANAG*
Ga0070658_1080118213300005327Corn RhizosphereHQALVDGMASQLRLQGASVPEVASSLACWNPVSLQHRVSELEATNAG*
Ga0070658_1131260913300005327Corn RhizosphereMFIRSSYQALVDGMASQLKSQGASIPEVASSLERWNPVLLHRRVSELEATNAG*
Ga0070658_1170988423300005327Corn RhizosphereQALVDGMASQLRLQGASVPEVASSLAHWNPVSLQHRVSELEATNAG*
Ga0070658_1182578523300005327Corn RhizosphereMLICSSHQALVNGLASQLKSQGASTPEVASSLERWNPVLLHRRVSELEATNAG*
Ga0070680_10102072013300005336Corn RhizosphereIRSSYQALVDGMVGQLKSQGASIPEVASSLERWNPVLLRGRVSELEATNAG*
Ga0070680_10159437813300005336Corn RhizosphereMASQLKLQGASVPERASSLARWNPVLLQQRVSDLEAANAG*
Ga0070680_10176313923300005336Corn RhizosphereSSHQALVDGMASQLRLQGASVPEVASSLACWNPVSLQHRVSELEATNAG*
Ga0070680_10200501123300005336Corn RhizosphereMFIRSSYQALVDGMASQLKSQGASIPEVALSLERWNPVLLHRRVSELEATNAG*
Ga0070682_10091866523300005337Corn RhizosphereMFIRSSYQALVDGMASQLKSQGASIPEVASSLERWNPVLLRGRVSELEATNAG*
Ga0070660_10080276213300005339Corn RhizosphereMLICSSRQALVNGLASQLKSQGASTPEVASSLERWNPVLLHRRVSELEATNAG*
Ga0070660_10151360113300005339Corn RhizosphereVDGMASQLKLQGASVPERALSLARWNPVLLQQRVSDLEAANAG*
Ga0070661_10040630133300005344Corn RhizosphereMFIRSSYQALVDEMISQLKSHGASLPEVASSLERWNPVLLPHRVSELEATNAG*
Ga0070661_10080236213300005344Corn RhizosphereMFIRSSYQALVDGMASQLKSQGASIPEVASSLERWNPVLLHRRVSELEAINS
Ga0070663_10041469933300005455Corn RhizosphereIIRSSYQALVDGMVGQLKSQGASIPEVASSLERWNPVLLRSRVSELEAANAG*
Ga0070663_10152996333300005455Corn RhizosphereMASQLRLQGASVPEGASSLARWNPVLLQHRVSDLEATNAG*
Ga0070663_10190840723300005455Corn RhizosphereQALVDGMASQLKLQGASVPERASSLARWNPVLLQQRVSDLEATNAG*
Ga0070662_10098459313300005457Corn RhizosphereHQALVDGMASQLRLQGASVPEVASSLACWNPVSLQHRISELEATNAG*
Ga0070662_10122804523300005457Corn RhizosphereMLIRSSYQALVDGMVGQLKSQGASIPEVASSLERWNPVLLRGRVSELEATNAG*
Ga0070662_10130934813300005457Corn RhizosphereMASQLRLQGASVPEVASSLACWNPVSLQRRVSELEATNAGR
Ga0070662_10180864913300005457Corn RhizosphereVITLICFPHQALVDGMAGQLRLQGASIPEVASSLSCWNPVSLQRRISELEATNTG*
Ga0070662_10200138723300005457Corn RhizospherePYQALVDGMASQLRLQGVSVPEGASSLARWNPVLLQERVSDLEAANAG*
Ga0070681_1038133913300005458Corn RhizosphereITLICSPYQALVDGMASQLRLQGASVPEVASSLARWNPVLLQHRVSDLEATNAS*
Ga0070681_1039859623300005458Corn RhizosphereMFIRSSYQALVDGMVGQLKSQGASIPEVASSLERWNPVLLRGRVSELEATNAG*
Ga0070679_10060784613300005530Corn RhizosphereTAVITLICSPYQALVDGMASQLKLQGASVPERASSLARWNPVLLQQRVSDLEATNAG*
Ga0070679_10118630013300005530Corn RhizosphereVDEMASQLKLQGASVPERASSLARWNPVLLQQRVSDLEATNA
Ga0068857_10175275023300005577Corn RhizosphereMLIRSSYQALVDGMVGQLKSQGASIPEVASSLERWNPVLLRGRVSELEATNAD*
Ga0068857_10175780713300005577Corn RhizosphereVNGLVSQLKSQGASTPEVASSLECWNPVLLRRRVSELEAINAGQCP
Ga0068857_10178681023300005577Corn RhizosphereMASQLKLQGASVPERASSLARWNLVLLQQRVSDLEAANAS*
Ga0068856_10232832613300005614Corn RhizosphereAIMFIRSSYQALVDGVVGQLKSQGASISEVASSLERWNPVLLRGRVSELEATNAG*
Ga0068851_1063384733300005834Corn RhizosphereYTVRTTVITLICSSYQALVDGMASQLRLQGASVPEGASSLACWNLVLLQQRISDLEATNAG*
Ga0079217_1033716423300006876Agricultural SoilMLIRSSYQALVDGMASQLKSQGASIPEVASSLERWNPVLLHRHVSELEATNAG*
Ga0079217_1034649423300006876Agricultural SoilMFICSSYQALVDGMVSQLKSHGASIPEVASSLERWNPVLLHRRVSELEATNAG*
Ga0079226_1053081623300006879Agricultural SoilMASQLRLQGASVPEVASSLARWNPVSLQHRVSELEATNAG*
Ga0079218_1026379813300007004Agricultural SoilLIRSSYQALVDGMVGQLKSQGASIPEVASSLERWNPVLLQSRVSELEAANAG*
Ga0079218_1205898513300007004Agricultural SoilPYQALVDGMASQLRLQGASIPKGASSLARWNPVLLQHRVSNLEATNAS*
Ga0105237_1206739623300009545Corn RhizosphereSPYQTLVDEMASQLRLQGASVPEGASSLARWNPVLLQHRVSDLEATNAG*
Ga0105237_1274336723300009545Corn RhizosphereMLICSSRQALVNGLASQLKSQGASIPEVASSLECWNPVLLRGRVSELEATNAGQ*
Ga0157296_1016884923300012905SoilSHQALVDGMASQLRSQGASIPEVASSFERWNPVSLHRRVSELEATNAG*
Ga0157296_1038068523300012905SoilVIMFIRSSHLALVDGMASQLRSQGAFIPEVASSLEHWNPVSLHRRVSELEATNAG*
Ga0157371_1030813423300013102Corn RhizosphereMFIRSSYQALMDGMASQLKSQGASIPEVALSLERWNPVLLHRRVSELEATNAG*
Ga0157370_1195005723300013104Corn RhizosphereVDGMASQLRLQGASVPEVTSSLACWNPVSLQHRVSELEATNAG*
Ga0157372_1135854613300013307Corn RhizosphereVNGMASQLRLQGASVPEVASSLACWNPVSLQRRVSELEATNAGRCSFPSSS
Ga0135282_1094313300014716Maize PhyllosphereLRLQGASVPEGALSLTHWNPVLLQQRVSDLEMANAG*
Ga0206351_1014558823300020077Corn, Switchgrass And Miscanthus RhizosphereVDGIVGQLKSQGASIPEVASSLERWNPVLLRGRASELEATNAG
Ga0214108_1051173813300020815Food WasteMLICSSHQALVNGLASQLKSQGASTPEVASSLERWNPVLLHRRVSELEATNAG
Ga0214108_1078651913300020815Food WasteTFVIMFICSSHQALVDGMASQLRSQGASIPEVASSLERWNPVSLHRRVSELEATNAG
Ga0214108_1080847823300020815Food WasteMSSRLKLQGASVLEGALSLARWNPVLLQQRVSDLEAANAG
Ga0214090_1103974823300020816Food WasteMFIRSSYQALVDGMVGQLKSQGASIPEVASSLECWNPVLLRGRVSELEAANAG
Ga0226662_1007790923300021966Food WasteMLICSSRQALVNGLASQLKSQGASTPEVASSLERWNPVLLHRRV
Ga0226662_1026736823300021966Food WasteMFIRSSYQALVNGLASQLKSQGASIPEVASSLERWNPVLLHRRVSELEATNAG
Ga0226662_1029183533300021966Food WasteMASQLRLQGASVPEGASSLARWNPVLLQHRVSNLEATNAG
Ga0255814_1006170833300023205Food WasteVDEMAGQLRSQGASVPERALSLMHWNPVLLQRRVSELEMTNAG
Ga0255814_1074700523300023205Food WasteMFIRSSYQALVNGLASQLKSQGASIPEVASSIERWNPVLLRRRVSELEAANVG
Ga0255814_1085881823300023205Food WasteMLIRSSYQALVDGMVGQLKSQGASIPEVASSLERWNPVLLRGRVSELEATNAG
Ga0255814_1123487823300023205Food WasteMLIRSSYQALVDGMVGQLKSQGASIPEVASSLDRWNPVLLRGRVSELEA
Ga0256702_1072950013300023300Food WasteDGMASQLRLQGASVPEVASSLACWNPVSLQHRVSELEATNAG
Ga0256702_1106730423300023300Food WasteMLIRSSHQALVDGMASQLRSQGAFIPEVASSLEHWNPVSLHRRVSELEATNAG
Ga0256702_1153683623300023300Food WasteGMASQLRLQGAPVPEVASSLARWNPVLLQHCVSDLEATNAG
Ga0256702_1236850513300023300Food WasteDGMASQLRLQGASVPEGALSLARWNPVLLQHRVSDMEATNAG
Ga0207705_1077691013300025909Corn RhizosphereMFIRSSYQALVDGMASQLKSQGASIPEVASSLERWNPVLLHRRVSELEATNAG
Ga0207705_1123585523300025909Corn RhizosphereMFIRSSYQALVDGVVGQLKSQGASIPEVASSLERWNPVLLRGRVSELEATNAG
Ga0207705_1147159723300025909Corn RhizosphereMFIRSSHQALVDGMASQLRSQGASIPEVASSFERWNPVSLHRRVSELEATNAG
Ga0207707_1081938013300025912Corn RhizosphereSQLKLQGASVPERASSLARWNPVLLQQRVSDLEAANAG
Ga0207707_1120616323300025912Corn RhizosphereMLICSSRQALVNGLASQLKSQGASIPEVASSLECWNPVLLRGRVSELEATNAGQCPFFFF
Ga0207707_1163419613300025912Corn RhizosphereSQYQALVDGMASQLKLQGASVPERASSLARWNPVLLQQRVSDLEATNAG
Ga0207660_1135477613300025917Corn RhizosphereAVIILICSQYQALVDGMASQLKLQGASVPERASSLARWNPVLLQQRVSDLEAANAG
Ga0207660_1166657823300025917Corn RhizosphereMASQLKLQGASVPERASSLARWNPVLLQQRVSDLEA
Ga0207657_1042668913300025919Corn RhizosphereMLIRSSYQALVDGMVGQLKSPGASIPEVASSLERWNPVLLRGRVSELE
Ga0207657_1063683113300025919Corn RhizosphereRSSYQALVDEMASQLKSQGASIPEVASSLERWNPVLLHRRVSELEATNAG
Ga0207657_1120280323300025919Corn RhizosphereMFIRSSYQALVDGMASQLKSQGASIPEVASSLERWNPVLLRGRVSELEATNA
Ga0207657_1147056523300025919Corn RhizosphereMASQLRLQGASAPEGASSLARWNPVLLQQRVSGLEATN
Ga0207649_1085300133300025920Corn RhizosphereMFIRSSYQALVDEMISQLKSHGASLPEVASSLERWNPVLLPHRVSELEATNAG
Ga0207649_1093959523300025920Corn RhizosphereMFIRSSYQALVDGMASQLKSQGASIPEVASSLERWNPVLLHRRVSELEAINSG
Ga0207649_1117488513300025920Corn RhizosphereSSHQALVDGMASQLRLQGASVPEVASSLACWNPVSLQHRVSELEATNAG
Ga0207649_1143710213300025920Corn RhizosphereMASQLKLQGASVPEGALSLARWNPVLLQQRVSDLEAANAG
Ga0207649_1157399313300025920Corn RhizosphereVNGLVSQLKSQGASTPEVASSLECWNPVLLRRRVSELEAINAGQCPF
Ga0207649_1166396423300025920Corn RhizosphereMFIRSSYQALVDGMVSQLKSQGASIPEVASSLERWNPVLLRGRVSELEATNAG
Ga0207652_1039154513300025921Corn RhizosphereLKSQGASIPEVASSLERWNPVLLHRRVSELEATNAG
Ga0207706_1011432333300025933Corn RhizosphereMASQLRLQGASVPEVASSLACWNPVSLHRRVSELEATNAG
Ga0207706_1056438023300025933Corn RhizosphereMLICSSRQALVNGLASQLKSQGASTPEVASSLERWNPVLLHRRVSELEATNAG
Ga0207706_1102748523300025933Corn RhizosphereMFIRSSYQALVDGMASQLKSQGASIPEVASSLERWNPVLLRGRVSELEATNAG
Ga0207706_1167166013300025933Corn RhizosphereWLQGASVPEVASSLARWNPVLLQHRVSDLEATNAG
Ga0207679_1089390723300025945Corn RhizosphereMASQLKLQGASVPEGASSLARWNPVLLQQRVSDLEAANAG
Ga0207678_1078389813300026067Corn RhizosphereLICSQYQALVDGMASQLKLQGASVPERALSLAHWNPVLLQQRVSDLEAANAG
Ga0207678_1084251023300026067Corn RhizosphereMFIYSSHQALVDGMASQLRLQGASVPEVASSLACWNPVSLHRRASELEATNAG
Ga0207678_1142502013300026067Corn RhizosphereLVDEMAGQLRSQGASVPEGAMSLTHWNLVLLRQRVSNLEMANAG
Ga0207674_1054912813300026116Corn RhizosphereVNGLVSQLKSQGASTPEVASSLECWNPVLLRRRVSELEAINAGQ
Ga0209486_1066999623300027886Agricultural SoilMFIRSSYQALVDGMASQLRSQGVSIPEVASSLERWNPVSLHRRVSELEATNAG
Ga0311022_1041691113300029799Anaerobic Digester DigestateMFICSSHQALVDGMASQLRSQGASIPEVASSLERWNPVSLHRRVSELEATNAGWC
Ga0311022_1213998123300029799Anaerobic Digester DigestateMFIRSSYQALVDGMANQLKSQGASIPEVASSLERWNPVLLHRRVSELEATNAG
Ga0311022_1294480813300029799Anaerobic Digester DigestateQALVDGMASQLRLQGASVPEVASSLACWNPVSLQHRVSELEATNAG
Ga0311022_1486285813300029799Anaerobic Digester DigestateLICSPYQALVDGMASQLRLQGASVPEGVLSLARWNPVLLQHRVSDFEATSVG
Ga0307408_10113934213300031548RhizosphereLKSHGASIPEVASSLERWNPVLLHRRVSELEATNAG
Ga0307408_10233272623300031548RhizosphereMFIRSSYQALVDGMASQLKSQGASIPEVALSLERWNPVLLHRRVSELEATNAG
Ga0307413_1177277013300031824RhizosphereLVDGMASQLRLQGTSVPEGALSLARWNPVLLQHRVSDLEATNAG
Ga0307406_1123566133300031901RhizosphereLRLQGASVPEVASSLARWNPVSLQHRVSDLEATNAG
Ga0307406_1128699723300031901RhizosphereMASQLKLQGASVPEGALSLARWNLVLLQRRVSDLEAANTG
Ga0307409_10118253023300031995RhizosphereMLICSSRQALVNGLASQLKSQGASTPEVASSLERWNPVLLRRRVSELEATNAG
Ga0307416_10202559413300032002RhizosphereMFIRSSYQALVDGMVSQLKSHGASIPEVASSLERWNPVLLHRRVSELEATNAG
Ga0307416_10212863213300032002RhizosphereVDGMASQLRLQGASVPEGASSLACWNPVLLQHRVSDLEATNAG
Ga0307416_10214222513300032002RhizosphereLRLQGAPVPEGALSLARWNLVLLRHRVSDLEATNAG
Ga0307416_10273159923300032002RhizosphereHQALVDGMASQLRLQGASVPEVASSLACWNPVSLHRRVSELEATNAG
Ga0307411_1150529323300032005RhizosphereMLICSSRQALVNGLVSQLKSQGASTPEVASSLERWNPVLLHRRVSELEATNAG

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.