Scaffold Ga0180008_1021091

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0180008_1021091

Scaffold Ga0180008_1021091

Overview

Basic Information
Taxon OID	3300014613 Open in IMG/M
Scaffold ID	Ga0180008_1021091 Open in IMG/M
Source Dataset Name	Groundwater microbial communities from the Aspo Hard Rock Laboratory (HRL) deep subsurface site, Sweden - MM_PW_MetaG
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2697
Total Scaffold Genes	10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	9 (90.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Groundwater Microbial Communities From Three Deep Subsurface Sites In Europe

Source Dataset Sampling Location
Location Name	Sweden: Oskarshamn
Coordinates	Lat. (^o)	57.4344	Long. (^o)	16.66	Alt. (m)		Depth (m)	171
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F084899	Metagenome	112	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0180008_10210915	F084899	GAGG	MTDKLEELKKELEKIDWTIDYGSVKVQIRQGKPTLITIERTVRLD*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.