Scaffold Ga0134457_1000201

Overview

Basic Information

• Taxon OID: 3300014572
• Scaffold ID: Ga0134457_1000201
• Source Dataset Name: Human fecal microbial communities from obese patients in Germany - AS65_6
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Hohenheim
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 45289
• Total Scaffold Genes: 34
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (11.76%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Obese Patients In Germany

Source Dataset Sampling Location

• Location Name: Germany
• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F105374	Metagenome	100	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0134457_10002015	F105374	N/A	LRPGFGAAENIRYLVLSKGVFAMKKRVALLVALCIWKVVAAQTPYGEMPERFRPDTLPCRLGGGVCFGMDGLDAAIPRGGGASSCRDPRVVFVAGDTLITFISVAGVANTALGDPVCRFYGRNVARVVSRMRRVTGGRMGAADNDFPDDPDFAELQGVVIENQRYPWESHAAGDSAYRLPVARSLVGGKEDPLLGSDMRRRYVRLLTEVSVELKAGGTRPFVHVVYLLPDP*