Basic Information | |
---|---|
Taxon OID | 3300014571 Open in IMG/M |
Scaffold ID | Ga0134369_100546 Open in IMG/M |
Source Dataset Name | Human fecal microbial communities from obese patients in Germany - AS60_0 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Hohenheim |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 31697 |
Total Scaffold Genes | 31 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 21 (67.74%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Obese Patients In Germany |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Germany | |||||||
Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F090515 | Metagenome | 108 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0134369_10054627 | F090515 | GGAG | VTTCCKAGQKAALQGTAPGRVACLEFAGGEKRKTNIAADYAVKALAFTALLCRHIGSIRTFLKS* |
⦗Top⦘ |