Scaffold Ga0182000_10013038

Overview

Basic Information

• Taxon OID: 3300014487
• Scaffold ID: Ga0182000_10013038
• Source Dataset Name: Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2067
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Agave Microbial Communities From California, Usa, And Mexico

Source Dataset Sampling Location

• Location Name: Mexico: Magueyal, Guanajuato
• Coordinates
  • Lat. (^o): 21.195
  • Long. (^o): -100.439

Associated Families

Family	Category	Number of Sequences	3D Structure?
F086096	Metagenome	111	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0182000_100130382	F086096	AGG	MTDIGRSRRLWRQSFFILLGVSVVVIGILLIVRPDKKVSYAGESRDTAEQGVGIVAKLLEEQQPPATRSNILKLLRHDNPRARIFATDTTVAIGSLTFFFSKNGRLERVMTGNR*