Scaffold Ga0135352_104105

Overview

Basic Information

• Taxon OID: 3300014357
• Scaffold ID: Ga0135352_104105
• Source Dataset Name: Human colon tissue microbial communities from Howard University Cancer Center, USA - CC0929
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: HiThru Analytics LLC
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1194
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Unclassified → Human Colon Tissue → Human Fecal And Colon Tissue Microbial Communities From Howard University Cancer Center, Usa

Source Dataset Sampling Location

• Location Name: USA: Washington, D.C
• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F047125	Metagenome / Metatranscriptome	150	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0135352_1041052	F047125	AGGA	MDVALLLMVLGVMLSGFWAADALDHMRKEILQQEGKRRGWWS*