3300014357: Human colon tissue microbial communities from Howard University Cancer Center, USA - CC0929

Overview

Basic Information

• IMG/M Taxon OID: 3300014357
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0121343 | Gp0152886 | Ga0135352
• Sample Name: Human colon tissue microbial communities from Howard University Cancer Center, USA - CC0929
• Sequencing Status: Permanent Draft
• Sequencing Center: HiThru Analytics LLC
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 31743415
• Sequencing Scaffolds: 2
• Novel Protein Genes: 3
• Associated Families: 3

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium	1
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora → Bovidae → Bovinae → Bos → Bos indicus x Bos taurus	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Human Fecal And Colon Tissue Microbial Communities From Howard University Cancer Center, Usa
• Type: Host-Associated
• Taxonomy: Host-Associated → Human → Digestive System → Large Intestine → Unclassified → Human Colon Tissue → Human Fecal And Colon Tissue Microbial Communities From Howard University Cancer Center, Usa

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal proximal gut

Location Information

• Location: USA: Washington, D.C
• Coordinates
  • Lat. (^o): N/A
  • Long. (^o): N/A
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F001445	Metagenome	692	Y
F047125	Metagenome / Metatranscriptome	150	N
F078004	Metagenome	117	N

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0135352_104105	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium	1194
Ga0135352_112838	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora → Bovidae → Bovinae → Bos → Bos indicus x Bos taurus	592

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0135352_102763	Ga0135352_1027631	F078004	LSSRNTDFLFRDLLFRKSSTGGLSAVAGSAALDVHMLRHTLIITIINALYRLTVDTDGMAWMRQRITERLSSLSLLRKALAAGAVTITGMLTSHHDVSLAAQTVLVIGTIFH
Ga0135352_104105	Ga0135352_1041052	F047125	MDVALLLMVLGVMLSGFWAADALDHMRKEILQQEGKRRGWWS*
Ga0135352_112838	Ga0135352_1128382	F001445	HFHALEKEMATHSSVLAWRIPGTGEPGGLPSMGSHRVGHD*