NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181528_10000124

Scaffold Ga0181528_10000124


Overview

Basic Information
Taxon OID3300014167 Open in IMG/M
Scaffold IDGa0181528_10000124 Open in IMG/M
Source Dataset NamePeatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)71521
Total Scaffold Genes66 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)43 (65.15%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog → Peatland Microbial Communities From Minnesota, Usa, Analyzing Carbon Cycling And Trace Gas Fluxes

Source Dataset Sampling Location
Location NameUSA: Michigan
CoordinatesLat. (o)47.1149Long. (o)-88.5476Alt. (m)Depth (m).1 to .2
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F067178Metagenome126Y
F078103Metagenome / Metatranscriptome116Y

Sequences

Protein IDFamilyRBSSequence
Ga0181528_1000012426F078103N/AMSLALVAVIILSLAAGVGLGYAIIFGILDLFDRSRHIIKAAPAQVLTTPAGSD*
Ga0181528_100001249F067178AGGMVVSEVAITVSIELLARRAHLSLATILVDRSLLALALLVLIVRPPKSQWLPRSPRLAWLRVVTGGLTFVGWFGAIGLLSGRVTQAVLLLDALILAYVRGPRRSYERRTLLVLATALVLFAAEAVREPGTVLNAPRGIAFLFIALASRAATYKVWERAQGRDEHLFWLIAPALVGAAFGGAFLGIGTHSGLQALSLSMWGAMLLVAMVGLTGYFYMNTVMSLLGAFYTRVVELWQVPALWAVHLLTDKSRIDLLEGGLGMLVACASAYTYLQHRKGQRLER*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.