Scaffold Ga0181523_10119209

Overview

Basic Information

• Taxon OID: 3300014165
• Scaffold ID: Ga0181523_10119209
• Source Dataset Name: Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1573
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (40.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog → Peatland Microbial Communities From Minnesota, Usa, Analyzing Carbon Cycling And Trace Gas Fluxes

Source Dataset Sampling Location

• Location Name: USA: Michigan
• Coordinates
  • Lat. (^o): 47.1149
  • Long. (^o): -88.5476
  • Depth (m): .3 to .4

Associated Families

Family	Category	Number of Sequences	3D Structure?
F033180	Metagenome / Metatranscriptome	178	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0181523_101192091	F033180	N/A	DLALRSNPVSKRFVLENLVLDLTAEPKLQEAGWLQDELPV*