| Basic Information | |
|---|---|
| Family ID | F033180 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 178 |
| Average Sequence Length | 39 residues |
| Representative Sequence | DLALRSNPVSKRMVLERLVMDLTTEPKLETPGWMQEQLPV |
| Number of Associated Samples | 146 |
| Number of Associated Scaffolds | 178 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.44 % |
| % of genes from short scaffolds (< 2000 bps) | 88.20 % |
| Associated GOLD sequencing projects | 141 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (74.719 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (12.360 % of family members) |
| Environment Ontology (ENVO) | Unclassified (20.787 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.506 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 27.94% β-sheet: 0.00% Coil/Unstructured: 72.06% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 178 Family Scaffolds |
|---|---|---|
| PF00797 | Acetyltransf_2 | 19.66 |
| PF01649 | Ribosomal_S20p | 11.80 |
| PF04140 | ICMT | 5.06 |
| PF14559 | TPR_19 | 3.37 |
| PF01844 | HNH | 2.25 |
| PF11138 | DUF2911 | 1.69 |
| PF02566 | OsmC | 1.69 |
| PF02636 | Methyltransf_28 | 1.69 |
| PF13414 | TPR_11 | 1.12 |
| PF01244 | Peptidase_M19 | 1.12 |
| PF01872 | RibD_C | 1.12 |
| PF02182 | SAD_SRA | 1.12 |
| PF13602 | ADH_zinc_N_2 | 1.12 |
| PF13432 | TPR_16 | 1.12 |
| PF08713 | DNA_alkylation | 0.56 |
| PF00144 | Beta-lactamase | 0.56 |
| PF01336 | tRNA_anti-codon | 0.56 |
| PF00004 | AAA | 0.56 |
| PF09720 | Unstab_antitox | 0.56 |
| PF13560 | HTH_31 | 0.56 |
| PF03706 | LPG_synthase_TM | 0.56 |
| PF00082 | Peptidase_S8 | 0.56 |
| PF13358 | DDE_3 | 0.56 |
| PF02130 | YbeY | 0.56 |
| PF08240 | ADH_N | 0.56 |
| PF09970 | DUF2204 | 0.56 |
| PF08447 | PAS_3 | 0.56 |
| PF12833 | HTH_18 | 0.56 |
| PF14853 | Fis1_TPR_C | 0.56 |
| PF03471 | CorC_HlyC | 0.56 |
| PF13643 | DUF4145 | 0.56 |
| PF01595 | CNNM | 0.56 |
| PF12779 | WXXGXW | 0.56 |
| PF01909 | NTP_transf_2 | 0.56 |
| PF02371 | Transposase_20 | 0.56 |
| PF02311 | AraC_binding | 0.56 |
| PF13624 | SurA_N_3 | 0.56 |
| PF12796 | Ank_2 | 0.56 |
| PF00909 | Ammonium_transp | 0.56 |
| PF07228 | SpoIIE | 0.56 |
| PF14693 | Ribosomal_TL5_C | 0.56 |
| PF00583 | Acetyltransf_1 | 0.56 |
| PF05016 | ParE_toxin | 0.56 |
| PF00756 | Esterase | 0.56 |
| PF02562 | PhoH | 0.56 |
| COG ID | Name | Functional Category | % Frequency in 178 Family Scaffolds |
|---|---|---|---|
| COG2162 | Arylamine N-acetyltransferase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 19.66 |
| COG0268 | Ribosomal protein S20 | Translation, ribosomal structure and biogenesis [J] | 11.80 |
| COG1565 | SAM-dependent methyltransferase, MidA family | General function prediction only [R] | 1.69 |
| COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 1.69 |
| COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 1.69 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 1.12 |
| COG2355 | Zn-dependent dipeptidase, microsomal dipeptidase homolog | Posttranslational modification, protein turnover, chaperones [O] | 1.12 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 1.12 |
| COG1702 | Phosphate starvation-inducible protein PhoH, predicted ATPase | Signal transduction mechanisms [T] | 0.56 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.56 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.56 |
| COG1875 | Predicted ribonuclease YlaK, contains NYN-type RNase and PhoH-family ATPase domains | General function prediction only [R] | 0.56 |
| COG0392 | Predicted membrane flippase AglD2/YbhN, UPF0104 family | Cell wall/membrane/envelope biogenesis [M] | 0.56 |
| COG0319 | ssRNA-specific RNase YbeY, 16S rRNA maturation enzyme | Translation, ribosomal structure and biogenesis [J] | 0.56 |
| COG0004 | Ammonia channel protein AmtB | Inorganic ion transport and metabolism [P] | 0.56 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.56 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.56 |
| COG4912 | 3-methyladenine DNA glycosylase AlkD | Replication, recombination and repair [L] | 0.56 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 74.72 % |
| Unclassified | root | N/A | 25.28 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001180|JGI12695J13573_1007202 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 749 | Open in IMG/M |
| 3300001593|JGI12635J15846_10308325 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
| 3300002568|C688J35102_118486087 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 564 | Open in IMG/M |
| 3300004092|Ga0062389_100435257 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1442 | Open in IMG/M |
| 3300004092|Ga0062389_101773875 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
| 3300004602|Ga0068960_1132635 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
| 3300005167|Ga0066672_11031455 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
| 3300005176|Ga0066679_10996437 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 522 | Open in IMG/M |
| 3300005176|Ga0066679_10998686 | Not Available | 521 | Open in IMG/M |
| 3300005536|Ga0070697_101792744 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300005542|Ga0070732_10099751 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1711 | Open in IMG/M |
| 3300005575|Ga0066702_10168223 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1309 | Open in IMG/M |
| 3300005598|Ga0066706_10347597 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1175 | Open in IMG/M |
| 3300005602|Ga0070762_11116983 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300005904|Ga0075280_10044598 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 836 | Open in IMG/M |
| 3300005995|Ga0066790_10440316 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300006059|Ga0075017_101068349 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300006086|Ga0075019_10611611 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300006086|Ga0075019_11147396 | Not Available | 505 | Open in IMG/M |
| 3300006162|Ga0075030_100412912 | All Organisms → cellular organisms → Bacteria | 1075 | Open in IMG/M |
| 3300006162|Ga0075030_100428770 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCGC AG-212-P17 | 1053 | Open in IMG/M |
| 3300006173|Ga0070716_100713392 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300006173|Ga0070716_101077967 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300006800|Ga0066660_11382575 | Not Available | 551 | Open in IMG/M |
| 3300009038|Ga0099829_10674065 | Not Available | 859 | Open in IMG/M |
| 3300009090|Ga0099827_10727787 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
| 3300009143|Ga0099792_10918506 | Not Available | 580 | Open in IMG/M |
| 3300009177|Ga0105248_11180895 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 865 | Open in IMG/M |
| 3300009522|Ga0116218_1124464 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1173 | Open in IMG/M |
| 3300009522|Ga0116218_1314860 | Not Available | 700 | Open in IMG/M |
| 3300009638|Ga0116113_1101075 | Not Available | 696 | Open in IMG/M |
| 3300009698|Ga0116216_10519291 | Not Available | 720 | Open in IMG/M |
| 3300009792|Ga0126374_10757315 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 737 | Open in IMG/M |
| 3300009839|Ga0116223_10612435 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 628 | Open in IMG/M |
| 3300010043|Ga0126380_11991998 | Not Available | 531 | Open in IMG/M |
| 3300010341|Ga0074045_10018003 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 5619 | Open in IMG/M |
| 3300010341|Ga0074045_10776344 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 606 | Open in IMG/M |
| 3300010366|Ga0126379_11189666 | Not Available | 868 | Open in IMG/M |
| 3300010371|Ga0134125_12293374 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300010376|Ga0126381_100251965 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2393 | Open in IMG/M |
| 3300010398|Ga0126383_10109099 | All Organisms → cellular organisms → Bacteria | 2493 | Open in IMG/M |
| 3300011120|Ga0150983_14396902 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300011120|Ga0150983_15628404 | Not Available | 570 | Open in IMG/M |
| 3300011269|Ga0137392_10446077 | All Organisms → cellular organisms → Bacteria | 1075 | Open in IMG/M |
| 3300011271|Ga0137393_10271255 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1442 | Open in IMG/M |
| 3300011271|Ga0137393_10961428 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300012189|Ga0137388_11743746 | Not Available | 556 | Open in IMG/M |
| 3300012200|Ga0137382_10025724 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3453 | Open in IMG/M |
| 3300012200|Ga0137382_10522483 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 844 | Open in IMG/M |
| 3300012202|Ga0137363_11359318 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300012210|Ga0137378_10460957 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1176 | Open in IMG/M |
| 3300012361|Ga0137360_11548451 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 568 | Open in IMG/M |
| 3300012363|Ga0137390_10237482 | All Organisms → cellular organisms → Bacteria | 1808 | Open in IMG/M |
| 3300012363|Ga0137390_11398801 | Not Available | 644 | Open in IMG/M |
| 3300012683|Ga0137398_10074882 | All Organisms → cellular organisms → Bacteria | 2073 | Open in IMG/M |
| 3300012683|Ga0137398_10677576 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300012917|Ga0137395_10322002 | All Organisms → cellular organisms → Bacteria | 1098 | Open in IMG/M |
| 3300012929|Ga0137404_10403049 | All Organisms → cellular organisms → Bacteria | 1206 | Open in IMG/M |
| 3300012929|Ga0137404_11520349 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300012958|Ga0164299_10614684 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300014154|Ga0134075_10364044 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 635 | Open in IMG/M |
| 3300014155|Ga0181524_10318266 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300014156|Ga0181518_10070112 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2024 | Open in IMG/M |
| 3300014165|Ga0181523_10119209 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium | 1573 | Open in IMG/M |
| 3300014167|Ga0181528_10505344 | Not Available | 665 | Open in IMG/M |
| 3300014199|Ga0181535_10635707 | Not Available | 610 | Open in IMG/M |
| 3300014489|Ga0182018_10395430 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300014489|Ga0182018_10636690 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300014493|Ga0182016_10711276 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 563 | Open in IMG/M |
| 3300014657|Ga0181522_10228884 | Not Available | 1097 | Open in IMG/M |
| 3300015372|Ga0132256_103635084 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300016270|Ga0182036_10911996 | Not Available | 721 | Open in IMG/M |
| 3300016294|Ga0182041_10900718 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300016357|Ga0182032_11660095 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300016445|Ga0182038_12187849 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
| 3300017822|Ga0187802_10453882 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
| 3300017823|Ga0187818_10066842 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1548 | Open in IMG/M |
| 3300017935|Ga0187848_10028379 | All Organisms → cellular organisms → Bacteria | 2852 | Open in IMG/M |
| 3300017937|Ga0187809_10351332 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300017942|Ga0187808_10342781 | Not Available | 677 | Open in IMG/M |
| 3300017946|Ga0187879_10664018 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300017975|Ga0187782_10367473 | Not Available | 1090 | Open in IMG/M |
| 3300017975|Ga0187782_11472543 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300017995|Ga0187816_10167925 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
| 3300017995|Ga0187816_10352315 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 650 | Open in IMG/M |
| 3300018003|Ga0187876_1262030 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 560 | Open in IMG/M |
| 3300018016|Ga0187880_1429691 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 549 | Open in IMG/M |
| 3300018034|Ga0187863_10008009 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 7095 | Open in IMG/M |
| 3300018034|Ga0187863_10128726 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1414 | Open in IMG/M |
| 3300018034|Ga0187863_10785393 | Not Available | 540 | Open in IMG/M |
| 3300018042|Ga0187871_10067499 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2108 | Open in IMG/M |
| 3300018044|Ga0187890_10054385 | All Organisms → cellular organisms → Bacteria | 2377 | Open in IMG/M |
| 3300018085|Ga0187772_10996847 | Not Available | 612 | Open in IMG/M |
| 3300018085|Ga0187772_11384371 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
| 3300018086|Ga0187769_10788344 | Not Available | 718 | Open in IMG/M |
| 3300018468|Ga0066662_10845272 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 893 | Open in IMG/M |
| 3300018468|Ga0066662_11997763 | Not Available | 607 | Open in IMG/M |
| 3300019278|Ga0187800_1685644 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 771 | Open in IMG/M |
| 3300021168|Ga0210406_10409605 | All Organisms → cellular organisms → Bacteria | 1085 | Open in IMG/M |
| 3300021171|Ga0210405_10674962 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300021181|Ga0210388_10439308 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1147 | Open in IMG/M |
| 3300021181|Ga0210388_11673343 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
| 3300021404|Ga0210389_10226487 | All Organisms → cellular organisms → Bacteria | 1461 | Open in IMG/M |
| 3300021404|Ga0210389_11431652 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300021407|Ga0210383_11701144 | Not Available | 517 | Open in IMG/M |
| 3300021432|Ga0210384_10888879 | Not Available | 791 | Open in IMG/M |
| 3300021433|Ga0210391_10818612 | Not Available | 728 | Open in IMG/M |
| 3300021476|Ga0187846_10340720 | Not Available | 619 | Open in IMG/M |
| 3300021479|Ga0210410_10321451 | All Organisms → cellular organisms → Bacteria | 1388 | Open in IMG/M |
| 3300021559|Ga0210409_10026612 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5587 | Open in IMG/M |
| 3300022881|Ga0224545_1012769 | All Organisms → cellular organisms → Bacteria | 1258 | Open in IMG/M |
| 3300023250|Ga0224544_1044431 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300024176|Ga0224565_1018166 | Not Available | 761 | Open in IMG/M |
| 3300025412|Ga0208194_1034654 | Not Available | 792 | Open in IMG/M |
| 3300025477|Ga0208192_1088936 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300025498|Ga0208819_1047897 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1001 | Open in IMG/M |
| 3300025898|Ga0207692_10350104 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 910 | Open in IMG/M |
| 3300025917|Ga0207660_10386134 | Not Available | 1126 | Open in IMG/M |
| 3300025941|Ga0207711_10822256 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 865 | Open in IMG/M |
| 3300026078|Ga0207702_11375427 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 700 | Open in IMG/M |
| 3300026555|Ga0179593_1220960 | All Organisms → cellular organisms → Bacteria | 2602 | Open in IMG/M |
| 3300026887|Ga0207805_1012633 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
| 3300027047|Ga0208730_1041167 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300027064|Ga0208724_1021620 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300027330|Ga0207777_1008255 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2272 | Open in IMG/M |
| 3300027330|Ga0207777_1090297 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300027570|Ga0208043_1190810 | Not Available | 521 | Open in IMG/M |
| 3300027575|Ga0209525_1008368 | All Organisms → cellular organisms → Bacteria | 2449 | Open in IMG/M |
| 3300027643|Ga0209076_1128491 | Not Available | 714 | Open in IMG/M |
| 3300027737|Ga0209038_10162521 | Not Available | 676 | Open in IMG/M |
| 3300027795|Ga0209139_10339289 | Not Available | 526 | Open in IMG/M |
| 3300027812|Ga0209656_10125051 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1319 | Open in IMG/M |
| 3300027825|Ga0209039_10196677 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 821 | Open in IMG/M |
| 3300027825|Ga0209039_10417286 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 511 | Open in IMG/M |
| 3300027854|Ga0209517_10404323 | Not Available | 766 | Open in IMG/M |
| 3300027869|Ga0209579_10759199 | Not Available | 524 | Open in IMG/M |
| 3300027882|Ga0209590_10040084 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 2546 | Open in IMG/M |
| 3300027889|Ga0209380_10039748 | All Organisms → cellular organisms → Bacteria | 2665 | Open in IMG/M |
| 3300027889|Ga0209380_10391803 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
| 3300027911|Ga0209698_10017391 | All Organisms → cellular organisms → Bacteria | 6934 | Open in IMG/M |
| 3300027911|Ga0209698_10374578 | All Organisms → cellular organisms → Bacteria | 1116 | Open in IMG/M |
| 3300027911|Ga0209698_10418072 | Not Available | 1046 | Open in IMG/M |
| 3300028565|Ga0302145_10189618 | Not Available | 688 | Open in IMG/M |
| 3300028649|Ga0302162_10020407 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1487 | Open in IMG/M |
| 3300030007|Ga0311338_10275311 | All Organisms → cellular organisms → Bacteria | 1876 | Open in IMG/M |
| 3300030740|Ga0265460_12219887 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 578 | Open in IMG/M |
| 3300030746|Ga0302312_10335531 | Not Available | 566 | Open in IMG/M |
| 3300030878|Ga0265770_1034696 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 860 | Open in IMG/M |
| 3300031057|Ga0170834_112065941 | All Organisms → cellular organisms → Bacteria | 946 | Open in IMG/M |
| 3300031231|Ga0170824_120019573 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2318 | Open in IMG/M |
| 3300031474|Ga0170818_104928912 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 939 | Open in IMG/M |
| 3300031525|Ga0302326_12824451 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300031668|Ga0318542_10614295 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300031718|Ga0307474_10099483 | All Organisms → cellular organisms → Bacteria | 2173 | Open in IMG/M |
| 3300031718|Ga0307474_10609628 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
| 3300031754|Ga0307475_10950685 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300031782|Ga0318552_10721058 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus → Terriglobus aquaticus | 509 | Open in IMG/M |
| 3300031824|Ga0307413_12069120 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300031942|Ga0310916_10695293 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
| 3300031942|Ga0310916_11230996 | Not Available | 618 | Open in IMG/M |
| 3300031946|Ga0310910_11488482 | Not Available | 519 | Open in IMG/M |
| 3300031954|Ga0306926_12136720 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300032002|Ga0307416_100329840 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1533 | Open in IMG/M |
| 3300032004|Ga0307414_10427960 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1156 | Open in IMG/M |
| 3300032091|Ga0318577_10613451 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300032094|Ga0318540_10086303 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1461 | Open in IMG/M |
| 3300032160|Ga0311301_11700421 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 759 | Open in IMG/M |
| 3300032180|Ga0307471_101418571 | Not Available | 854 | Open in IMG/M |
| 3300032515|Ga0348332_12418098 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1090 | Open in IMG/M |
| 3300032770|Ga0335085_11193951 | Not Available | 809 | Open in IMG/M |
| 3300032782|Ga0335082_11693597 | Not Available | 506 | Open in IMG/M |
| 3300032805|Ga0335078_11164814 | Not Available | 894 | Open in IMG/M |
| 3300032893|Ga0335069_10108636 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3493 | Open in IMG/M |
| 3300032893|Ga0335069_10312180 | All Organisms → cellular organisms → Bacteria | 1868 | Open in IMG/M |
| 3300032893|Ga0335069_10650856 | All Organisms → cellular organisms → Bacteria | 1203 | Open in IMG/M |
| 3300032954|Ga0335083_10029321 | All Organisms → cellular organisms → Bacteria | 6162 | Open in IMG/M |
| 3300032954|Ga0335083_10509960 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
| 3300033004|Ga0335084_10645763 | All Organisms → cellular organisms → Bacteria | 1081 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 12.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.67% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 5.06% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.06% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.49% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.49% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.93% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.93% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 3.37% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.37% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.37% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.25% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.25% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.25% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.81% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.81% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.69% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.69% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.69% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.69% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.12% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.12% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.12% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.12% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 1.12% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.12% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.12% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.56% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.56% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.56% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.56% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.56% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.56% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.56% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.56% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.56% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.56% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.56% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.56% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.56% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.56% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.56% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001180 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004602 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 52 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005904 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_404 | Environmental | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009638 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014155 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaG | Environmental | Open in IMG/M |
| 3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014167 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaG | Environmental | Open in IMG/M |
| 3300014199 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018003 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_40 | Environmental | Open in IMG/M |
| 3300018016 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019278 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022881 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 20-24 | Environmental | Open in IMG/M |
| 3300023250 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 10-14 | Environmental | Open in IMG/M |
| 3300024176 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU1 | Environmental | Open in IMG/M |
| 3300025412 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025477 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025498 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300026887 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 49 (SPAdes) | Environmental | Open in IMG/M |
| 3300027047 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF042 (SPAdes) | Environmental | Open in IMG/M |
| 3300027064 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF003 (SPAdes) | Environmental | Open in IMG/M |
| 3300027330 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 35 (SPAdes) | Environmental | Open in IMG/M |
| 3300027570 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027575 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028565 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_3 | Environmental | Open in IMG/M |
| 3300028649 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E2_2 | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030740 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assembly | Environmental | Open in IMG/M |
| 3300030746 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_1 | Environmental | Open in IMG/M |
| 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12695J13573_10072021 | 3300001180 | Forest Soil | SNPVSKRMVLERLVMDLTTEPKLETPGWMQEGLSY* |
| JGI12635J15846_103083253 | 3300001593 | Forest Soil | ADLALRSNPVSKRMVMERLVMDLTTEPKPETPGWMQDQLPV* |
| C688J35102_1184860871 | 3300002568 | Soil | DLALRSNPVSKRLVLEKLVLDLMAEPKPEVAWLQEQFPV* |
| Ga0062389_1004352573 | 3300004092 | Bog Forest Soil | KADLALRSNPPGKRLVLEKLVLDLAAEPKLEVPGGWMQEELPV* |
| Ga0062389_1017738751 | 3300004092 | Bog Forest Soil | LALRSNPVSKRMVLERLVIELTTEPKLEAQGWMQNQLPV* |
| Ga0068960_11326353 | 3300004602 | Peatlands Soil | DLALRSNPTSKRMVLEKLVLDLASESKLEAAGGWMQEELPV* |
| Ga0066672_110314551 | 3300005167 | Soil | DLALRSNPASKRLVLEKLVLDLTAEPKPELGWSQEELSV* |
| Ga0066679_109964372 | 3300005176 | Soil | DLALRSNAPSKRLVLEKLVLDLTAEPKPEPEWMQEELGV* |
| Ga0066679_109986862 | 3300005176 | Soil | KADLALRSNAPSKRLVLEKLVLDLTAEPKPEPEWMQEELGV* |
| Ga0070697_1017927442 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | LALRSNPTSKRMVLEKLVLDLAAEPKLEATGGWMQEELPV* |
| Ga0070732_100997511 | 3300005542 | Surface Soil | RSNPVSKRMVLERLVIDLTSEPKLETPGWMQDQLPV* |
| Ga0066702_101682231 | 3300005575 | Soil | LRSNPPSKRLVLEQLVLELASEPKPEINLWRQQELGV* |
| Ga0066706_103475972 | 3300005598 | Soil | DLALRSNAPTKRLVLEKLVLDLTAEPKPETEWMQEELGV* |
| Ga0070762_111169831 | 3300005602 | Soil | KADLALRSNPVSKRMVLERLVMDLTTEPKLETPGWMQEHLPV* |
| Ga0075280_100445981 | 3300005904 | Rice Paddy Soil | ALRSNPASKRLVLEKLVLELTAEAQPVTPAWQQHELPV* |
| Ga0066790_104403162 | 3300005995 | Soil | RSNPVSKRMVLERLVMDLTTEPKLETPGWMQEQLPV* |
| Ga0075017_1010683491 | 3300006059 | Watersheds | LRSNPVSKRMVLERLVMDLTSEAKPETPGWMQDQLPV* |
| Ga0075019_106116111 | 3300006086 | Watersheds | ADLSLRSNPVSKRMVLERLVMDLTAEPKLEAPGWMQDQLPV* |
| Ga0075019_111473961 | 3300006086 | Watersheds | PPGKRLILEKLVLDLCAEPKPETAGGWMQEELPV* |
| Ga0075030_1004129121 | 3300006162 | Watersheds | DLSLRSNPVSKRMVLERLVMDLTAEPKLEAPGWMQDQLPV* |
| Ga0075030_1004287701 | 3300006162 | Watersheds | RSNPVSKRMVLERLVMDLTTEPKLEAPGWMQDQLPV* |
| Ga0070716_1007133922 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | AKADLALRSNPVSKRMVLERLILDLTTEPKVESPSWMQDQLPV* |
| Ga0070716_1010779671 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | DLALRSNPVSKRMVLERLILDLTTEPKVESPGWMQDQLPV* |
| Ga0066660_113825752 | 3300006800 | Soil | LRSNAASKRLVLEKLVLDLTAEPKPELGWSQEELSV* |
| Ga0099829_106740652 | 3300009038 | Vadose Zone Soil | SNPPSKRMVLEKLVLDLTAEPKPEPEWMQEELGV* |
| Ga0099827_107277871 | 3300009090 | Vadose Zone Soil | AKADLALRSNPVSKRMVLERLVMDLTTEPKLETPGWMQDQLPV* |
| Ga0099792_109185062 | 3300009143 | Vadose Zone Soil | DLALRSNPVSKRMVLERLVMELTTEPKLEAAGWMQEQLPV* |
| Ga0105248_111808951 | 3300009177 | Switchgrass Rhizosphere | KTDLALRSNPVSKRFVLERLVLDLTAQPKPESLWMQEELPV* |
| Ga0116218_11244642 | 3300009522 | Peatlands Soil | SNPPGKRLILEKLVLDLSAEPKLEAAGGGMQEELPV* |
| Ga0116218_13148602 | 3300009522 | Peatlands Soil | SNPVSKRMVLERLVMDLTTEHKLEAPGWMQEQLPV* |
| Ga0116113_11010751 | 3300009638 | Peatland | LALRSNPVSKRMVLERLVMDLTTEPKMEAPGWMQDQLPV* |
| Ga0116216_105192911 | 3300009698 | Peatlands Soil | VARADLALRSNPVSKRLVLENLVLELSSEPRVVEPGWLQEQLPV* |
| Ga0126374_107573152 | 3300009792 | Tropical Forest Soil | AIRLIAKADLALRSNPVSKRMVLERLVVNLTSEPEVAMPGWMQEQLPV* |
| Ga0116223_106124352 | 3300009839 | Peatlands Soil | AKADLALRSNPVSKRMVLERLVMDLTTEPKPETPGWMQDQLPV* |
| Ga0126380_119919982 | 3300010043 | Tropical Forest Soil | SSPPSKRLVLEKLVLELTADAEAAPVWMQEQLEV* |
| Ga0074045_100180031 | 3300010341 | Bog Forest Soil | NPVSKRMVLERLVMDLTSEPKLETPGWMQDQLPV* |
| Ga0074045_107763442 | 3300010341 | Bog Forest Soil | LALRSNPPGKRLILEKLVLDLAGEPKLEAAGGWM* |
| Ga0126379_111896662 | 3300010366 | Tropical Forest Soil | ALRANPPGKRLMLEKLVLDLTAEAKAEQLGWSQDEFPV* |
| Ga0134125_122933742 | 3300010371 | Terrestrial Soil | IRLIAKTDLALRSNPVSKRFVLERLVLDLTAQPKPESLWMQEELPV* |
| Ga0126381_1002519651 | 3300010376 | Tropical Forest Soil | AKADLALRSNPVSKRMVVERLVIDLTREPQLTTPGWMQEQLPV* |
| Ga0126383_101090995 | 3300010398 | Tropical Forest Soil | LRSNPVSKRLVLERLVMDLTTEPKVEAPGWMQDQLPV* |
| Ga0150983_143969022 | 3300011120 | Forest Soil | VALRSNPVNKRLVLERLVMDLATESRLDTPEWMQEQLPV* |
| Ga0150983_156284041 | 3300011120 | Forest Soil | ADLALRSNPVSKRMVLERLVMDLTTELKPEAPGWMQDQLPV* |
| Ga0137392_104460772 | 3300011269 | Vadose Zone Soil | ALRSNPVSKRMVLERLVMDLTTEPKLETPGWMQEQLPV* |
| Ga0137393_102712551 | 3300011271 | Vadose Zone Soil | DLALRSNPVSKRMVLERLVMDLTTEAKLEAAGWMQDQLPV* |
| Ga0137393_109614282 | 3300011271 | Vadose Zone Soil | SNPVSKRMVLERLVMDLTTEPKLETPGWMQEQLPV* |
| Ga0137388_117437461 | 3300012189 | Vadose Zone Soil | NPTSKRMVLEKLVLDLAIEPKLEAAGGWMQEELPV* |
| Ga0137382_100257246 | 3300012200 | Vadose Zone Soil | DLTLRSNPVSKRMVLERLVIDLTTEPKLETPGWMQEQLPV* |
| Ga0137382_105224832 | 3300012200 | Vadose Zone Soil | LRSNPVSKRLVLEKLVLDLTAEAAPTGPAWQQEQLPV* |
| Ga0137363_113593181 | 3300012202 | Vadose Zone Soil | NPVSKRMVLERLVMDLTTEAKLEAPGWMQDQLPV* |
| Ga0137378_104609572 | 3300012210 | Vadose Zone Soil | KADLALRSNPVSKRMVLERLVMDLTTEAKLETPEWMQDQLPV* |
| Ga0137360_115484512 | 3300012361 | Vadose Zone Soil | LALRSNPVSKRMVLEQLVIDLTSEPKLEPPSWMQEQLPV* |
| Ga0137390_102374821 | 3300012363 | Vadose Zone Soil | SNPVSKRMVLERLVMDLTTEAKLEAAGWMQDQLPV* |
| Ga0137390_113988011 | 3300012363 | Vadose Zone Soil | NPVSKRLVLEKLVMDLTTEPKVETAGWMQEQLPV* |
| Ga0137398_100748821 | 3300012683 | Vadose Zone Soil | RSNPPGKRLILEKLVLDLCAEVKVESAGGWMQEELPV* |
| Ga0137398_106775761 | 3300012683 | Vadose Zone Soil | LRSNPVSKRMVLERLVMDLTTEVKLEAPGWMQEQLPV* |
| Ga0137395_103220023 | 3300012917 | Vadose Zone Soil | ALRSNPVSKRMVLERLVMDLTTEQKLETPGWMQEQLPV* |
| Ga0137404_104030493 | 3300012929 | Vadose Zone Soil | DLALRSNPPTKRLVLEKLVLELTAEAKPESAWMQNELPV* |
| Ga0137404_115203491 | 3300012929 | Vadose Zone Soil | LALRSNPPTKRFVLEKLILDLTAEAKPEIAGWSQEDLPV* |
| Ga0164299_106146842 | 3300012958 | Soil | RLIAKTDLALRSNPVSKRFVLERLVLDLTAQPKPESLWMQEELPV* |
| Ga0134075_103640442 | 3300014154 | Grasslands Soil | RSNPASKRLVLEKLVLDLTAEPKPELGWSQEELSV* |
| Ga0181524_103182662 | 3300014155 | Bog | AKADLALRSNPPGKRLVLEKLILDLSADAKPEAASGWMQEELPV* |
| Ga0181518_100701123 | 3300014156 | Bog | ALRSNPTSKRMVLEKLVLDLAAEPKLEAAGGWMQEELPV* |
| Ga0181523_101192091 | 3300014165 | Bog | DLALRSNPVSKRFVLENLVLDLTAEPKLQEAGWLQDELPV* |
| Ga0181528_105053442 | 3300014167 | Bog | NPPGKRLILEKLVLDLAGEPKPESSSGWMQEELPV* |
| Ga0181535_106357071 | 3300014199 | Bog | AKADAALRTNPVSKRLVLENLVLDLAAEQKETAIPVWQQESLLD* |
| Ga0182018_103954301 | 3300014489 | Palsa | LRSNPVSKRMVLERLVMDLTAEPKLEVAGWMQEQLPVL* |
| Ga0182018_106366902 | 3300014489 | Palsa | RSNPPSKRLILEKLVLDLSAEPKPEAASGWVQEGLPV* |
| Ga0182016_107112761 | 3300014493 | Bog | RSNPVSKRMVLERLVMDLTTEPKMEAPGWMQEQLPV* |
| Ga0181522_102288842 | 3300014657 | Bog | DLALRSNPVSKRMVLERLVMELTAEPKVEAPGWMQEQLPV* |
| Ga0132256_1036350842 | 3300015372 | Arabidopsis Rhizosphere | DLALRSNPPTKRLVLVKLVLDLTSEARPEPEWSQHEFQI* |
| Ga0182036_109119961 | 3300016270 | Soil | SNAVSKRLVLENLVLELTAEPKLQKAGWLQDELPV |
| Ga0182041_109007181 | 3300016294 | Soil | LTNAIRRIARADLAIRSNPVSKRLVLENLVLDLTAEPKALEAGWLQEQLPV |
| Ga0182032_116600952 | 3300016357 | Soil | ARADLAIRSNPVSKRLVLENLVLDLTAEPKALEAGWLQEQLPV |
| Ga0182038_121878492 | 3300016445 | Soil | RSNPVSKRMVLERLVIDLTSEPKIETPGWMQEQLPV |
| Ga0187802_104538822 | 3300017822 | Freshwater Sediment | DLALRSNPVSKRMVLERLVMDLTSEPKLETPGWMQEHLPV |
| Ga0187818_100668423 | 3300017823 | Freshwater Sediment | SNPTSKRMVLEKLVLDLAGESKLEAAGGWMQEELPV |
| Ga0187848_100283795 | 3300017935 | Peatland | RSNPPGKRLVLEKLVLDLATEPKPEVAGGWMQEELPV |
| Ga0187809_103513321 | 3300017937 | Freshwater Sediment | DLALRSNPPTKRLVLEKLIMDLTAEARPDPLWQQDELPV |
| Ga0187808_103427811 | 3300017942 | Freshwater Sediment | ADLALRSNPVSKRMVLERLVIDLTSEPKLETPGWMQEQLPV |
| Ga0187879_106640182 | 3300017946 | Peatland | KADLALRSNPVSKRMVLERLVMDLTTEPKLETPGWMQEQLPV |
| Ga0187782_103674733 | 3300017975 | Tropical Peatland | AKADLALRSNPVSKRLVLEKLVMDLTAEPKVESPGWMQDQLPV |
| Ga0187782_114725432 | 3300017975 | Tropical Peatland | KADLALRSNPVSKRMVLERLVMDLTTEPKVEAPGWMQDQLPV |
| Ga0187816_101679251 | 3300017995 | Freshwater Sediment | DLALRSNPVSKRMVLERLVIDLTSEPKLETPGWMQDQLPV |
| Ga0187816_103523151 | 3300017995 | Freshwater Sediment | LRSNPVSKRMVLERLVMDLTTEPKPEAPGWMQEQLPV |
| Ga0187876_12620302 | 3300018003 | Peatland | DLALRSNPVSKRMVLERLVMDLTTEPKLETPGWMQEQLPV |
| Ga0187880_14296912 | 3300018016 | Peatland | ALRSNPVSKRMVLERLVMDLTTEPKLETPGWMQEQLPV |
| Ga0187863_100080091 | 3300018034 | Peatland | SNPVSKRMVLERLVVDLTTEPKLETPGWMQEQLPV |
| Ga0187863_101287261 | 3300018034 | Peatland | ALRSNPVSKRMVLERLVMDLTTEPKLEIPGWMQEQLPV |
| Ga0187863_107853932 | 3300018034 | Peatland | LRSNPVSKRMVLERLVIDLTSEPKVETPGWMQEQLPV |
| Ga0187871_100674992 | 3300018042 | Peatland | SNPPGKRMILEKLVLDLSAEPKPEAADGWMQEQLPV |
| Ga0187890_100543854 | 3300018044 | Peatland | AKADLALRSNPVSKRMVLERLVMDLTTEPKLEAPGWMQEQLPV |
| Ga0187772_109968471 | 3300018085 | Tropical Peatland | DLALRSNPVSKRMVLERLVMDLTSEPKLETPGWMQDQLPV |
| Ga0187772_113843711 | 3300018085 | Tropical Peatland | ADLALRSNPVSKRMVLERLVMDLTAQPKLETPGWMQDQLPV |
| Ga0187769_107883441 | 3300018086 | Tropical Peatland | DLALRSNPVSKRMVLERLVMDLTTEPKLETPGWMQDQLPV |
| Ga0066662_108452721 | 3300018468 | Grasslands Soil | DLALRSTPASKRLVLEKVVLDLTAEPKPELGWSQEQLSV |
| Ga0066662_119977632 | 3300018468 | Grasslands Soil | LRSNPVSKRMVLEKLVLDLTAKPQVAAVLAQQEQLPV |
| Ga0187800_16856443 | 3300019278 | Peatland | KADLALRSNPVSKRMVLERLVMDLTSEPKLEAPGWMQDQLPV |
| Ga0210406_104096051 | 3300021168 | Soil | SNPTSKRMVLEKLVLDLAAEPKLEATGGWMQEELPV |
| Ga0210405_106749621 | 3300021171 | Soil | RSNPVSKRMVLERLVMDLTTEAKLEAPGWMQEQLPV |
| Ga0210388_104393081 | 3300021181 | Soil | SNPVSKRMVLERLVMDLTTEPKLETPGWMQEQLPV |
| Ga0210388_116733432 | 3300021181 | Soil | DLALRSNPVSKRMVLERLVMDLTTEAKLEAPAWMQEQLPV |
| Ga0210389_102264871 | 3300021404 | Soil | RSNPVSKRMVLERLVIDLTTEPKLETPGWMQEQLPV |
| Ga0210389_114316521 | 3300021404 | Soil | DLALRSNPPTKRLVLEKLVLDLTAEPRPESGWMQDELPV |
| Ga0210383_117011442 | 3300021407 | Soil | ALRSNPVSKRMVLERLVMDLTTEAKLETTGWMQEQLPV |
| Ga0210384_108888791 | 3300021432 | Soil | ADLALRSNPVSKRMVLERLVMDLTTETKLETPGWMQDQLPV |
| Ga0210391_108186122 | 3300021433 | Soil | LALRSNPVSKRMVLERLVMDLTAEAKIDTPGWMQEQLPV |
| Ga0187846_103407202 | 3300021476 | Biofilm | ADLALRSNPVSKRLVLEKLVIDLMAEPKPEVGWMQDELPV |
| Ga0210410_103214511 | 3300021479 | Soil | TDLALRSNPVSKRFVLEKLVLDLTSEPKPETGWMQEELPV |
| Ga0210409_100266127 | 3300021559 | Soil | LRSNPVSKRFVLEKLVLDLTSEPKPETGWMQEELPV |
| Ga0224545_10127691 | 3300022881 | Soil | LRSNPVSKRMVLERLVMDLTTEPKPETPGWMQDQLPV |
| Ga0224544_10444312 | 3300023250 | Soil | SNPVSKRMVLERLIMDLTTEAKLEAPGWMQEQLPV |
| Ga0224565_10181661 | 3300024176 | Plant Litter | LRSNPVSKRMVLERLVMDLTTEPKLETPGWMQEQLPV |
| Ga0208194_10346542 | 3300025412 | Peatland | ADLALRSNPVSKRMVLERLVMDLTTEPKMEAPGWMQDQLPV |
| Ga0208192_10889362 | 3300025477 | Peatland | ADLALRSNPPGKRLVLEKLVLDLATEPKLEATGGWMQEELLV |
| Ga0208819_10478972 | 3300025498 | Peatland | DLALRSNPPGKRMVLEKLVLDLAAEPKPEAAGGWMQEELPV |
| Ga0207692_103501042 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | DLALRSNPPGKRLVLEKLVLDLTSEAQPTAPAWQQHELPV |
| Ga0207660_103861341 | 3300025917 | Corn Rhizosphere | DLALRSNPVSKRMVLERLVMDLTTEPKVEAPGWMQDQLPV |
| Ga0207711_108222563 | 3300025941 | Switchgrass Rhizosphere | KTDLALRSNPVSKRFVLERLVLDLTAQPKPESLWMQEELPV |
| Ga0207702_113754272 | 3300026078 | Corn Rhizosphere | LALRSNPVSKRMVLERLVIDLTSEPKLETAGWMQEQLPV |
| Ga0179593_12209601 | 3300026555 | Vadose Zone Soil | KADLALRSNPTSKRMVLEKLVLDLSAEPKLEATGGWMQEELPV |
| Ga0207805_10126332 | 3300026887 | Tropical Forest Soil | RADLALRSNPVSKRLVLENLVLDLTAEPKLQEIAWMQEQLPV |
| Ga0208730_10411671 | 3300027047 | Forest Soil | TDLALRSNPTSKRMVLEKLVLDLTTEPKPEAGWMQEELPV |
| Ga0208724_10216201 | 3300027064 | Forest Soil | ALRSNPVSKRMVLERLVMDLTTEAKLEAPGWMQEQLPV |
| Ga0207777_10082551 | 3300027330 | Tropical Forest Soil | ARADLALRSNPVSKRLVLENLVLDLTAEPKLQEIAWMQEQLPV |
| Ga0207777_10902971 | 3300027330 | Tropical Forest Soil | ADLALRSNPPGKKLILEKLVLDLTAEVKIDTPGGWMQEELPV |
| Ga0208043_11908102 | 3300027570 | Peatlands Soil | ADLALRSNPTSKRMVLEKLVLDLASESKLEAAGGWMQEELPV |
| Ga0209525_10083681 | 3300027575 | Forest Soil | RSNPVSKRMVLERLVMDLTTEPKLETPGWMQEQLPV |
| Ga0209076_11284912 | 3300027643 | Vadose Zone Soil | SNPVSKRLVLEKLVMDLTTEPKVETAGWMQEQLPV |
| Ga0209038_101625211 | 3300027737 | Bog Forest Soil | ADLALRSNPVSKRMVLERLVMDLTTEAKLEAPGWMQEQLPV |
| Ga0209139_103392891 | 3300027795 | Bog Forest Soil | ALRSNPVSKRMVLERLVIDLTTEPKVEAPGWMQEQLPV |
| Ga0209656_101250514 | 3300027812 | Bog Forest Soil | ADLALRSNPVSKRLVLENLVLELTAEPKPQEVVWLQEQLPV |
| Ga0209039_101966773 | 3300027825 | Bog Forest Soil | DLALRSNPVSKRMVLERLVIDLTAEPKLEAPGWMQEQLPV |
| Ga0209039_104172861 | 3300027825 | Bog Forest Soil | LALRSNPPGKRLVLEKLVLDLAAEPRVEAAGGWMQEELPV |
| Ga0209517_104043232 | 3300027854 | Peatlands Soil | LRSNPVSKRMVLERLVMDLTTEPKLEAPGWMQEQLPV |
| Ga0209579_107591992 | 3300027869 | Surface Soil | DLALRSNPVSKRMVLERLVMDLTTEPKVETPGWMQDQLPV |
| Ga0209590_100400844 | 3300027882 | Vadose Zone Soil | KADLALRSNPVSKRMVLERLVMDLTTEPKLETPGWMQDQLPV |
| Ga0209380_100397481 | 3300027889 | Soil | ADLALRSNPPTKRLVLEKLVLDLTAEPRPESGWMQDELPV |
| Ga0209380_103918032 | 3300027889 | Soil | AKADLALRSNPVSKRMVLERLVMDLTTEAKLEAPGWMQEQLPV |
| Ga0209698_100173911 | 3300027911 | Watersheds | ALRSNPVSKRMVLERLVVNLTTEPKLEAPAWMQDQLPV |
| Ga0209698_103745782 | 3300027911 | Watersheds | ADLALRSNPVSKRMVLERLVMDLTTEPKPEAPGWMQDQLPV |
| Ga0209698_104180721 | 3300027911 | Watersheds | LRSNPVSKRMVLERLVMDLTAEPKLEAPGWMQDQLPV |
| Ga0302145_101896181 | 3300028565 | Bog | SNPVSKRMVLERLVMDLTADPKLEAPGWMQEQLPV |
| Ga0302162_100204074 | 3300028649 | Fen | ALRSNPVSKRLVLENLVLELTAEPKAVEAGWFQEQLPV |
| Ga0311338_102753113 | 3300030007 | Palsa | RSNPVSKRMVLERLVMDLTAEAKLETPGWMQEQLPV |
| Ga0265460_122198871 | 3300030740 | Soil | ALRSNPPTKRMVLEKLVLELTSEPKPEAGWMQEDLPV |
| Ga0302312_103355311 | 3300030746 | Palsa | AKADLALRSNPVSKRMVLERLVMDLTTEVKLEAPGWMQDQLPV |
| Ga0265770_10346962 | 3300030878 | Soil | SNPVSKRMVLERLVMDLTTEPKLEAQGWMQEQLPV |
| Ga0170834_1120659414 | 3300031057 | Forest Soil | RSNPVSKRMVLERLVMDLTTGPKLEAAGWMQEQSPV |
| Ga0170824_1200195732 | 3300031231 | Forest Soil | ALRSNPVGKRLVLEKLVLDLSAEPKPEPAAGWMQEELPV |
| Ga0170818_1049289121 | 3300031474 | Forest Soil | LALRSNPVSKRMVLERLVMDLTTEAKVETPGWMQEQLPV |
| Ga0302326_128244511 | 3300031525 | Palsa | IRLIAKADLALRSNPVSKKFAVEKLVLDLTAQPLPESGWMQEELPV |
| Ga0318542_106142951 | 3300031668 | Soil | IARADLALRSNPVSKQLVLENLVLDLTAEPKAVEVGWLEEQLPV |
| Ga0307474_100994833 | 3300031718 | Hardwood Forest Soil | SNPVSKRMVLERLVMDLTSEPKPETPGWMQDHLLV |
| Ga0307474_106096282 | 3300031718 | Hardwood Forest Soil | AKADLALRSNPVSKRMVLERLVIDLTTEPKLETPGWMQEQLPV |
| Ga0307475_109506852 | 3300031754 | Hardwood Forest Soil | ADLALRSNPVSKRMVLERLVMDLTTEPKLETPGWMQEQLPV |
| Ga0318552_107210582 | 3300031782 | Soil | ARADLAIRSNPVSKRLVLETLVLDLTAEPKAVEVTWLQEQLPV |
| Ga0307413_120691202 | 3300031824 | Rhizosphere | LALRSNAPSKRLVLEKLVLDLCAESKSIDGQTGWVQDELPV |
| Ga0310916_106952932 | 3300031942 | Soil | GAIRRIARADLALRSNPVSKRLVLENLVLDLTAEPKAVEVDWLKEQLPV |
| Ga0310916_112309961 | 3300031942 | Soil | ELTGAIQRIARADLALRSNPVSKRFVLENLVLELTAEPKVLEAGWLQEQLPV |
| Ga0310910_114884821 | 3300031946 | Soil | AIRRIARADLALRSNAVSKRLVLENLVLELTAEPKLQKAGWLQDELPV |
| Ga0306926_121367202 | 3300031954 | Soil | RIARADFALRSNPVSKRLVLENLVLDLTAEPKPQEVAWLQEQLPV |
| Ga0307416_1003298404 | 3300032002 | Rhizosphere | ARADLALRSNAPSKRLVLEKLVLDLCAESKSIDGQTGWVQDELPV |
| Ga0307414_104279603 | 3300032004 | Rhizosphere | APSKRLVLEKLVLDLCAEPKPIDGQAGWVQDELPV |
| Ga0318577_106134511 | 3300032091 | Soil | RIARADLALRANPVTKRLVLENLVLDLTAEPGISQEAWWQEQLPV |
| Ga0318540_100863034 | 3300032094 | Soil | SNPVSKRLVLENLVLDLTAEPKPQEIAWLQEQLPV |
| Ga0311301_117004212 | 3300032160 | Peatlands Soil | ALRSNPPGKRLILEKLVLDLSADPKLEAAGGGMQEELPV |
| Ga0307471_1014185711 | 3300032180 | Hardwood Forest Soil | LRSNPPTKRLVLEKLVLELTAEPKPESAWMQDELPV |
| Ga0348332_124180981 | 3300032515 | Plant Litter | ALRSNPPGKRLVLERMILDLVTETKLEANRGWMQEQLPV |
| Ga0335085_111939512 | 3300032770 | Soil | LALRSNPPTKRLVLEKLVLDLTAEPKEEVPGWSQEELSI |
| Ga0335082_116935971 | 3300032782 | Soil | LRSNAVSKRLVLENLVLDLTTEPKLQEAGWLQDELPV |
| Ga0335078_111648141 | 3300032805 | Soil | LRSNPVSKRMVLERLVMDLTTEPKLEAPAWMQEQLPV |
| Ga0335069_101086361 | 3300032893 | Soil | TDLALRSNPTSKRMVLEKLVLDLTTEPKPEIAGWSQDELPV |
| Ga0335069_103121801 | 3300032893 | Soil | KADLALRSNPVSKRMVLERLVMDLTSEPKVEAPGWMQDQLPV |
| Ga0335069_106508563 | 3300032893 | Soil | DLALRSNPVSKRMVLERLIMELTSEPEVAAPGWMQEQLPV |
| Ga0335083_100293216 | 3300032954 | Soil | VARADLALRSNAVSKRLVLENLVLDLTAEPKLQEAGWLQDELPV |
| Ga0335083_105099603 | 3300032954 | Soil | KADLALRSNPVSKRMVLERLVIDLTSEPKVEAPGWMQDQLPV |
| Ga0335084_106457633 | 3300033004 | Soil | TSALRRVARADLALRSNPSSKRLVLENLVLDLTTQPKLDAELGWLQEELPV |
| ⦗Top⦘ |