Scaffold Ga0180440_108518

Overview

Basic Information

• Taxon OID: 3300014147
• Scaffold ID: Ga0180440_108518
• Source Dataset Name: Chrysochromulina tobin associated microbial communities from unialgal haptophyte culture, Washington, USA - P5_4mM MetaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1512
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Modeled → Simulated Communities (Microbial Mixture) → Unclassified → Unclassified → Defined Medium → Chrysochromulina Tobin Associated Microbial Communities From Unialgal Haptophyte Culture In Seattle, Washington, Usa

Source Dataset Sampling Location

• Location Name: USA: Seattle, Washington
• Coordinates
  • Lat. (^o): 47.6519
  • Long. (^o): -122.3113

Associated Families

Family	Category	Number of Sequences	3D Structure?
F043264	Metagenome / Metatranscriptome	156	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0180440_1085181	F043264	N/A	VSTTADLTSALANTAVGRIVLASGTYLVSSVEFLITRSVILEAAVAGSVVLDAQGMGGKRVLRINLGSSEFV