NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0134344_1014741

Scaffold Ga0134344_1014741


Overview

Basic Information
Taxon OID3300014140 Open in IMG/M
Scaffold IDGa0134344_1014741 Open in IMG/M
Source Dataset NameHuman oral microbial communities of schizophrenia patients from Maryland, USA - ES_104
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterThe George Washington University (GWU)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1340
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Streptococcaceae → Streptococcus(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Oral Cavity → Throat → Human Oral → Human Oral Microbial Communities Of Schizophrenia Patients From Maryland, Usa

Source Dataset Sampling Location
Location NameUSA: Maryland
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F097527Metagenome104N

Sequences

Protein IDFamilyRBSSequence
Ga0134344_10147411F097527N/AMIYFKMEKIGNSTKTEKKKKTRPENLVFITIPAAGVEPARPCGHW

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.