| Basic Information | |
|---|---|
| Taxon OID | 3300014053 Open in IMG/M |
| Scaffold ID | Ga0119956_1021218 Open in IMG/M |
| Source Dataset Name | Contaminated water microbial communities from Hexachlorocyclohexane (HCH) contaminated sediment in Lucknow, India - Pond Sediment |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Delhi |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 515 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Pond → Sediment → Contaminated Water → Contaminated Water Microbial Communities From Pond Sediment In Lucknow, India |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | India: Chinhat, Lucknow | |||||||
| Coordinates | Lat. (o) | 26.5389 | Long. (o) | 81.2022 | Alt. (m) | Depth (m) | .1 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F095305 | Metagenome | 105 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0119956_10212182 | F095305 | AGGAGG | MTGSLSRFWIGLIVLAVALTCADAASAQRKVRFAYPSSADLGDIPSLLAWEQLKKQGIEVVPTFFPKTDLAVQAVVAG |
| ⦗Top⦘ |