Scaffold Ga0119956_1020571

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0119956_1020571

Scaffold Ga0119956_1020571

Overview

Basic Information
Taxon OID	3300014053 Open in IMG/M
Scaffold ID	Ga0119956_1020571 Open in IMG/M
Source Dataset Name	Contaminated water microbial communities from Hexachlorocyclohexane (HCH) contaminated sediment in Lucknow, India - Pond Sediment
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Delhi
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	519
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Pond → Sediment → Contaminated Water → Contaminated Water Microbial Communities From Pond Sediment In Lucknow, India

Source Dataset Sampling Location
Location Name	India: Chinhat, Lucknow
Coordinates	Lat. (^o)	26.5389	Long. (^o)	81.2022	Alt. (m)		Depth (m)	.1
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F041511	Metagenome / Metatranscriptome	160	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0119956_10205711	F041511	N/A	KEIKMTLVQKRINGTEYYTDDKVYYTFHKVKDTADTLWNFACMELGITKKSGFNSQETKAITDLAGISSLHPTKFLLLKEGNAVPVPYLPNGSADLHPDDIILRATVDPAAKPIAPSVVTVVPPSSLTKSVADRLKEIEDLLAMKLLSEPEYQDKRAKVIAEL*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.