NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0120109_1157816

Scaffold Ga0120109_1157816


Overview

Basic Information
Taxon OID3300014052 Open in IMG/M
Scaffold IDGa0120109_1157816 Open in IMG/M
Source Dataset NamePermafrost microbial communities from Nunavut, Canada - A23_35cm_12M
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Tennessee
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)531
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost → Permafrost Microbial Communities From Nunavut, Canada To Study Carbon Cycling

Source Dataset Sampling Location
Location NameCanada: Axel Heiberg Island, Nunavut
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m).35
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F085453Metagenome111Y

Sequences

Protein IDFamilyRBSSequence
Ga0120109_11578162F085453N/AVVARVLKPLLYVAAVLETDPEKAADRINTAQDALRERWQALRQTPLARDPERQRVEDAIRTLNMIRANELDPPA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.