Basic Information | |
---|---|
Taxon OID | 3300014042 Open in IMG/M |
Scaffold ID | Ga0117790_1059423 Open in IMG/M |
Source Dataset Name | Epidermal mucus viral and microbial communities from European eel in Spain - Ebro delta (0.22 um filter) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Valencia |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 639 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Host-Associated → Fish → Skin → Epidermal Mucus → Unclassified → Epidermal Mucus → Epidermal Mucus Viral And Microbial Communities From European Eel In Spain |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Spain: Alfacada pond | |||||||
Coordinates | Lat. (o) | 40.647955 | Long. (o) | -0.738702 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F090460 | Metagenome / Metatranscriptome | 108 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0117790_10594231 | F090460 | GGAGG | MVNDKFSDKEYWEGIRDACEYFKDELGIEDATDTTLYQQAKEELELV* |
⦗Top⦘ |