Basic Information | |
---|---|
Taxon OID | 3300014037 Open in IMG/M |
Scaffold ID | Ga0119816_1041979 Open in IMG/M |
Source Dataset Name | Human oral microbial communities from Los Angeles, CA, USA - S21-04-R |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of California, Los Angeles |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 996 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Human → Digestive System → Oral Cavity → Subgingival Plaque → Human Oral → Human Oral Microbial Communities From Los Angeles, Ca, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Los Angeles | |||||||
Coordinates | Lat. (o) | 34.0722 | Long. (o) | -118.4441 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F092230 | Metagenome | 107 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0119816_10419792 | F092230 | GAG | MVDKLQTHLLKAFLPLFIVCIIFVAFFRQIDCGGEGGYAFQISEWGAKLKNIYGTDFINKEIIVRDNTVQVDGIRCLYAVNRNEDGLSIYLLLSGGEYLTHNYVGSSFVKFSHSSEYSNMAYGEGSVEVSDSTSTGEVQNTEEKEALNKVDEAINNMRHLFASAIMVNLRVVELYKILTGCMILIAIVVIAGYYSY |
⦗Top⦘ |